Recombinant Full Length Human FAXDC2 Protein, GST-tagged

Cat.No. : FAXDC2-2670HF
Product Overview : Human FAXDC2 full-length ORF (NP_115761.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 191 amino acids
Description : FAXDC2 (Fatty Acid Hydroxylase Domain Containing 2) is a Protein Coding gene. Among its related pathways are cholesterol biosynthesis I and Metabolism. GO annotations related to this gene include oxidoreductase activity and iron ion binding. An important paralog of this gene is MSMO1.
Molecular Mass : 49.2 kDa
AA Sequence : MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAXDC2 fatty acid hydroxylase domain containing 2 [ Homo sapiens (human) ]
Official Symbol FAXDC2
Synonyms FAXDC2; fatty acid hydroxylase domain containing 2; C5ORF4; chromosome 5 open reading frame 4; uncharacterized protein C5orf4; FLJ13758; Fatty Acid Hydroxylase Domain Containing 2; Fatty Acid Hydroxylase Domain-Containing Protein 2; Chromosome 5 Open Reading Frame 4
Gene ID 10826
mRNA Refseq NM_032385
Protein Refseq NP_115761
MIM 619853
UniProt ID Q96IV6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAXDC2 Products

Required fields are marked with *

My Review for All FAXDC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon