Recombinant Human FBL, His-tagged
| Cat.No. : | FBL-28839TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 81-321 of Human Fibrillarin with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 137 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGE KRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIK PGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRS GRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIF ADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTAS AEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGV YRPPPKVKN |
| Sequence Similarities : | Belongs to the methyltransferase superfamily. Fibrillarin family. |
| Gene Name | FBL fibrillarin [ Homo sapiens ] |
| Official Symbol | FBL |
| Synonyms | FBL; fibrillarin; rRNA 2-O-methyltransferase fibrillarin; FIB; FLRN; RNU3IP1; |
| Gene ID | 2091 |
| mRNA Refseq | NM_001436 |
| Protein Refseq | NP_001427 |
| MIM | 134795 |
| Uniprot ID | P22087 |
| Chromosome Location | 19q13.1 |
| Pathway | Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
| Function | RNA binding; methyltransferase activity; protein binding; transferase activity; |
| ◆ Recombinant Proteins | ||
| FBL-3130M | Recombinant Mouse FBL Protein, His (Fc)-Avi-tagged | +Inquiry |
| FBL-791H | Recombinant Human Fibrillarin, His-tagged | +Inquiry |
| FBL-12762H | Recombinant Human FBL, His-tagged | +Inquiry |
| FBL-83H | Recombinant Human Fibrillarin Protein, GST-tagged | +Inquiry |
| FBL-2281R | Recombinant Rat FBL Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBL-6319HCL | Recombinant Human FBL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBL Products
Required fields are marked with *
My Review for All FBL Products
Required fields are marked with *
