Recombinant Human FBL, His-tagged

Cat.No. : FBL-28839TH
Product Overview : Recombinant fragment, corresponding to amino acids 81-321 of Human Fibrillarin with N terminal His tag; Predicted MWt 28 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 137 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGE KRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIK PGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRS GRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIF ADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTAS AEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGV YRPPPKVKN
Sequence Similarities : Belongs to the methyltransferase superfamily. Fibrillarin family.
Gene Name FBL fibrillarin [ Homo sapiens ]
Official Symbol FBL
Synonyms FBL; fibrillarin; rRNA 2-O-methyltransferase fibrillarin; FIB; FLRN; RNU3IP1;
Gene ID 2091
mRNA Refseq NM_001436
Protein Refseq NP_001427
MIM 134795
Uniprot ID P22087
Chromosome Location 19q13.1
Pathway Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function RNA binding; methyltransferase activity; protein binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBL Products

Required fields are marked with *

My Review for All FBL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon