Recombinant Human FBLN2
Cat.No. : | FBLN2-28902TH |
Product Overview : | Recombinant fragment of Human Fibulin 2 (aa 1076-1184) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 109 amino acids |
Description : | This gene encodes an extracellular matrix protein, which belongs to the fibulin family. This protein binds various extracellular ligands and calcium. It may play a role during organ development, in particular, during the differentiation of heart, skeletal and neuronal structures. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 37.620kDa inclusive of tags |
Tissue specificity : | Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGD TIALNIIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRDFA LDVEMKLWRQGSVTTFLAKMHIFFTTFAL |
Sequence Similarities : | Belongs to the fibulin family.Contains 3 anaphylatoxin-like domains.Contains 11 EGF-like domains. |
Gene Name | FBLN2 fibulin 2 [ Homo sapiens ] |
Official Symbol | FBLN2 |
Synonyms | FBLN2; fibulin 2; fibulin-2; |
Gene ID | 2199 |
mRNA Refseq | NM_001004019 |
Protein Refseq | NP_001004019 |
MIM | 135821 |
Uniprot ID | P98095 |
Chromosome Location | 3p25-p24 |
Function | calcium ion binding; extracellular matrix structural constituent; |
◆ Recombinant Proteins | ||
FBLN2-2600H | Recombinant Human FBLN2 Protein (Asp858-Leu1184), N-His tagged | +Inquiry |
FBLN2-198H | Recombinant Human FBLN2 protein, T7/His-tagged | +Inquiry |
FBLN2-159H | Recombinant Human FBLN2 Protein, His-tagged | +Inquiry |
FBLN2-4882HF | Recombinant Full Length Human FBLN2 Protein, GST-tagged | +Inquiry |
Fbln2-7896M | Recombinant Mouse Fbln2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBLN2 Products
Required fields are marked with *
My Review for All FBLN2 Products
Required fields are marked with *