Recombinant Human FBLN2

• Cat.No.: FBLN2-28902TH
• Product Overview: Recombinant fragment of Human Fibulin 2 (aa 1076-1184) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 109 amino acids
• Description: This gene encodes an extracellular matrix protein, which belongs to the fibulin family. This protein binds various extracellular ligands and calcium. It may play a role during organ development, in particular, during the differentiation of heart, skeletal and neuronal structures. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Weight: 37.620kDa inclusive of tags
• Tissue specificity: Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGD TIALNIIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRDFA LDVEMKLWRQGSVTTFLAKMHIFFTTFAL
• Sequence Similarities: Belongs to the fibulin family.Contains 3 anaphylatoxin-like domains.Contains 11 EGF-like domains.

Gene Information

• Gene Name: FBLN2 fibulin 2 [ Homo sapiens ]
• Official Symbol: FBLN2
• Synonyms: FBLN2; fibulin 2; fibulin-2
• Gene ID: 2199
• mRNA Refseq: NM_001004019
• Protein Refseq: NP_001004019
• MIM: 135821
• Uniprot ID: P98095
• Chromosome Location: 3p25-p24
• Function: calcium ion binding; extracellular matrix structural constituent