Recombinant Human FBLN2

Cat.No. : FBLN2-28902TH
Product Overview : Recombinant fragment of Human Fibulin 2 (aa 1076-1184) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 109 amino acids
Description : This gene encodes an extracellular matrix protein, which belongs to the fibulin family. This protein binds various extracellular ligands and calcium. It may play a role during organ development, in particular, during the differentiation of heart, skeletal and neuronal structures. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 37.620kDa inclusive of tags
Tissue specificity : Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGD TIALNIIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRDFA LDVEMKLWRQGSVTTFLAKMHIFFTTFAL
Sequence Similarities : Belongs to the fibulin family.Contains 3 anaphylatoxin-like domains.Contains 11 EGF-like domains.
Gene Name FBLN2 fibulin 2 [ Homo sapiens ]
Official Symbol FBLN2
Synonyms FBLN2; fibulin 2; fibulin-2;
Gene ID 2199
mRNA Refseq NM_001004019
Protein Refseq NP_001004019
MIM 135821
Uniprot ID P98095
Chromosome Location 3p25-p24
Function calcium ion binding; extracellular matrix structural constituent;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBLN2 Products

Required fields are marked with *

My Review for All FBLN2 Products

Required fields are marked with *

0
cart-icon