Recombinant Human FBN2 Protein, GST-tagged

• Cat.No.: FBN2-3879H
• Product Overview: Human FBN2 partial ORF ( NP_001990.2, 2776 a.a. - 2876 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a component of connective tissue microfibrils and may be involved in elastic fiber assembly. Mutations in this gene cause congenital contractural arachnodactyly. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.85 kDa
• AA Sequence: RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSYLHTAKKKLMPGTYTLEITSIP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBN2 fibrillin 2 [ Homo sapiens ]
• Official Symbol: FBN2
• Synonyms: FBN2; fibrillin 2; CCA, congenital contractural arachnodactyly; fibrillin-2; DA9; fibrillin 5; CCA
• Gene ID: 2201
• mRNA Refseq: NM_001999
• Protein Refseq: NP_001990
• MIM: 612570
• UniProt ID: P35556