Recombinant Human FBN2 Protein, GST-tagged
Cat.No. : | FBN2-3879H |
Product Overview : | Human FBN2 partial ORF ( NP_001990.2, 2776 a.a. - 2876 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a component of connective tissue microfibrils and may be involved in elastic fiber assembly. Mutations in this gene cause congenital contractural arachnodactyly. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.85 kDa |
AA Sequence : | RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSYLHTAKKKLMPGTYTLEITSIP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBN2 fibrillin 2 [ Homo sapiens ] |
Official Symbol | FBN2 |
Synonyms | FBN2; fibrillin 2; CCA, congenital contractural arachnodactyly; fibrillin-2; DA9; fibrillin 5; CCA; |
Gene ID | 2201 |
mRNA Refseq | NM_001999 |
Protein Refseq | NP_001990 |
MIM | 612570 |
UniProt ID | P35556 |
◆ Recombinant Proteins | ||
FBN2-28840TH | Recombinant Human FBN2 | +Inquiry |
FBN2-3013H | Recombinant Human FBN2 Protein (Thr1550-Cys1791), N-GST tagged | +Inquiry |
FBN2-516H | Recombinant Human FBN2 Protein, His/GST-tagged | +Inquiry |
FBN2-3879H | Recombinant Human FBN2 Protein, GST-tagged | +Inquiry |
FBN2-1466H | Recombinant Human FBN2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBN2 Products
Required fields are marked with *
My Review for All FBN2 Products
Required fields are marked with *