Recombinant Human FBN2 Protein, GST-tagged

Cat.No. : FBN2-3879H
Product Overview : Human FBN2 partial ORF ( NP_001990.2, 2776 a.a. - 2876 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a component of connective tissue microfibrils and may be involved in elastic fiber assembly. Mutations in this gene cause congenital contractural arachnodactyly. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.85 kDa
AA Sequence : RQKRSIHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILELRPAIQPLNNHIRYVISQGNDDSVFRIHQRNGLSYLHTAKKKLMPGTYTLEITSIP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBN2 fibrillin 2 [ Homo sapiens ]
Official Symbol FBN2
Synonyms FBN2; fibrillin 2; CCA, congenital contractural arachnodactyly; fibrillin-2; DA9; fibrillin 5; CCA;
Gene ID 2201
mRNA Refseq NM_001999
Protein Refseq NP_001990
MIM 612570
UniProt ID P35556

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBN2 Products

Required fields are marked with *

My Review for All FBN2 Products

Required fields are marked with *

0
cart-icon