Recombinant Human FBP2 Protein, GST-tagged
Cat.No. : | FBP2-3881H |
Product Overview : | Human FBP2 full-length ORF ( NP_003828.2, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 63.1 kDa |
AA Sequence : | MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBP2 fructose-1,6-bisphosphatase 2 [ Homo sapiens ] |
Official Symbol | FBP2 |
Synonyms | FBP2; fructose-1,6-bisphosphatase 2; fructose-1,6-bisphosphatase isozyme 2; FBPase 2; hexosediphosphatase; muscle fructose-bisphosphatase; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; MGC142192; |
Gene ID | 8789 |
mRNA Refseq | NM_003837 |
Protein Refseq | NP_003828 |
MIM | 603027 |
UniProt ID | O00757 |
◆ Recombinant Proteins | ||
FBP2-390H | Active Recombinant Human FBP2 Protein, His-tagged | +Inquiry |
FBP2-1206Z | Recombinant Zebrafish FBP2 | +Inquiry |
Fbp2-1468M | Recombinant Mouse Fbp2 Protein, His-tagged | +Inquiry |
FBP2-1469H | Recombinant Human FBP2 Protein, His-tagged | +Inquiry |
FBP2-5708M | Recombinant Mouse FBP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBP2-6315HCL | Recombinant Human FBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBP2 Products
Required fields are marked with *
My Review for All FBP2 Products
Required fields are marked with *
0
Inquiry Basket