Recombinant Human FBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FBP2-1110H |
| Product Overview : | FBP2 MS Standard C13 and N15-labeled recombinant protein (NP_003828) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. |
| Molecular Mass : | 36.8 kDa |
| AA Sequence : | MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FBP2 fructose-1,6-bisphosphatase 2 [ Homo sapiens (human) ] |
| Official Symbol | FBP2 |
| Synonyms | FBP2; fructose-1,6-bisphosphatase 2; fructose-1,6-bisphosphatase isozyme 2; FBPase 2; hexosediphosphatase; muscle fructose-bisphosphatase; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; MGC142192; |
| Gene ID | 8789 |
| mRNA Refseq | NM_003837 |
| Protein Refseq | NP_003828 |
| MIM | 603027 |
| UniProt ID | O00757 |
| ◆ Recombinant Proteins | ||
| FBP2-1941R | Recombinant Rat FBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fbp2-1024M | Recombinant Mouse Fbp2 Protein, MYC/DDK-tagged | +Inquiry |
| FBP2-3881H | Recombinant Human FBP2 Protein, GST-tagged | +Inquiry |
| FBP2-1206Z | Recombinant Zebrafish FBP2 | +Inquiry |
| FBP2-3137M | Recombinant Mouse FBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBP2-6315HCL | Recombinant Human FBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBP2 Products
Required fields are marked with *
My Review for All FBP2 Products
Required fields are marked with *
