Recombinant Human FBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FBP2-1110H |
Product Overview : | FBP2 MS Standard C13 and N15-labeled recombinant protein (NP_003828) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FBP2 fructose-1,6-bisphosphatase 2 [ Homo sapiens (human) ] |
Official Symbol | FBP2 |
Synonyms | FBP2; fructose-1,6-bisphosphatase 2; fructose-1,6-bisphosphatase isozyme 2; FBPase 2; hexosediphosphatase; muscle fructose-bisphosphatase; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; MGC142192; |
Gene ID | 8789 |
mRNA Refseq | NM_003837 |
Protein Refseq | NP_003828 |
MIM | 603027 |
UniProt ID | O00757 |
◆ Recombinant Proteins | ||
FBP2-369H | Recombinant Human fructose-1,6-bisphosphatase 2, His-tagged | +Inquiry |
FBP2-3137M | Recombinant Mouse FBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBP2-301626H | Recombinant Human FBP2 protein, GST-tagged | +Inquiry |
Fbp2-4949R | Recombinant Mouse Fbp2 protein | +Inquiry |
FBP2-3027H | Recombinant Human FBP2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBP2-6315HCL | Recombinant Human FBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBP2 Products
Required fields are marked with *
My Review for All FBP2 Products
Required fields are marked with *