Recombinant Human FBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FBP2-1110H
Product Overview : FBP2 MS Standard C13 and N15-labeled recombinant protein (NP_003828) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.
Molecular Mass : 36.8 kDa
AA Sequence : MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FBP2 fructose-1,6-bisphosphatase 2 [ Homo sapiens (human) ]
Official Symbol FBP2
Synonyms FBP2; fructose-1,6-bisphosphatase 2; fructose-1,6-bisphosphatase isozyme 2; FBPase 2; hexosediphosphatase; muscle fructose-bisphosphatase; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; MGC142192;
Gene ID 8789
mRNA Refseq NM_003837
Protein Refseq NP_003828
MIM 603027
UniProt ID O00757

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBP2 Products

Required fields are marked with *

My Review for All FBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon