Recombinant Human FBRS protein, His-tagged
Cat.No. : | FBRS-3104H |
Product Overview : | Recombinant Human FBRS protein(218-290 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 218-290 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PPEAARTPGSDKERPVERREPSITKEEKDRDLPFSRPQLRVSPATPKARAGEEGPRPTKESVRVKEERKEEAA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FBRS fibrosin [ Homo sapiens ] |
Official Symbol | FBRS |
Synonyms | FBRS; fibrosin; FBS1, fibrosin 1; probable fibrosin-1; FBS; FLJ11618; fibrosin 1; fibrogenic lymphokine; probable fibrosin-1 long transcript protein; FBS1; |
Gene ID | 64319 |
mRNA Refseq | NM_001105079 |
Protein Refseq | NP_001098549 |
MIM | 608601 |
UniProt ID | Q9HAH7 |
◆ Recombinant Proteins | ||
Fbrs-728M | Recombinant Mouse Fbrs Protein, His-tagged | +Inquiry |
FBRS-3138M | Recombinant Mouse FBRS Protein, His (Fc)-Avi-tagged | +Inquiry |
FBRS-301438H | Recombinant Human FBRS protein, GST-tagged | +Inquiry |
FBRS-3104H | Recombinant Human FBRS protein, His-tagged | +Inquiry |
FBRS-3883H | Recombinant Human FBRS Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBRS Products
Required fields are marked with *
My Review for All FBRS Products
Required fields are marked with *
0
Inquiry Basket