Recombinant Human FBRS protein, His-tagged
| Cat.No. : | FBRS-3104H |
| Product Overview : | Recombinant Human FBRS protein(218-290 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 218-290 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | PPEAARTPGSDKERPVERREPSITKEEKDRDLPFSRPQLRVSPATPKARAGEEGPRPTKESVRVKEERKEEAA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FBRS fibrosin [ Homo sapiens ] |
| Official Symbol | FBRS |
| Synonyms | FBRS; fibrosin; FBS1, fibrosin 1; probable fibrosin-1; FBS; FLJ11618; fibrosin 1; fibrogenic lymphokine; probable fibrosin-1 long transcript protein; FBS1; |
| Gene ID | 64319 |
| mRNA Refseq | NM_001105079 |
| Protein Refseq | NP_001098549 |
| MIM | 608601 |
| UniProt ID | Q9HAH7 |
| ◆ Recombinant Proteins | ||
| FBRS-301438H | Recombinant Human FBRS protein, GST-tagged | +Inquiry |
| FBRS-3883H | Recombinant Human FBRS Protein, GST-tagged | +Inquiry |
| FBRS-3104H | Recombinant Human FBRS protein, His-tagged | +Inquiry |
| FBRS-5709M | Recombinant Mouse FBRS Protein | +Inquiry |
| FBRS-4898HF | Recombinant Full Length Human FBRS Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBRS Products
Required fields are marked with *
My Review for All FBRS Products
Required fields are marked with *
