Recombinant Human FBXL16 Protein, GST-tagged
| Cat.No. : | FBXL16-3892H |
| Product Overview : | Human FBXL16 full-length ORF ( NP_699181.1, 1 a.a. - 479 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 78 kDa |
| AA Sequence : | MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSLAAPLSRAALAGGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLALGSLRLLSPAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBXL16 F-box and leucine-rich repeat protein 16 [ Homo sapiens ] |
| Official Symbol | FBXL16 |
| Synonyms | FBXL16; F-box and leucine-rich repeat protein 16; C16orf22, chromosome 16 open reading frame 22; F-box/LRR-repeat protein 16; Fbl16; MGC33974; c380A1.1 (novel protein); C16orf22; c380A1.1; FLJ33735; |
| Gene ID | 146330 |
| mRNA Refseq | NM_153350 |
| Protein Refseq | NP_699181 |
| MIM | 609082 |
| UniProt ID | Q8N461 |
| ◆ Recombinant Proteins | ||
| FBXL16-5715M | Recombinant Mouse FBXL16 Protein | +Inquiry |
| FBXL16-3142M | Recombinant Mouse FBXL16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FBXL16-2286R | Recombinant Rat FBXL16 Protein | +Inquiry |
| FBXL16-3892H | Recombinant Human FBXL16 Protein, GST-tagged | +Inquiry |
| FBXL16-1943R | Recombinant Rat FBXL16 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXL16 Products
Required fields are marked with *
My Review for All FBXL16 Products
Required fields are marked with *
