Recombinant Human FBXL19 Protein, GST-tagged

• Cat.No.: FBXL19-3897H
• Product Overview: Human FBXL19 partial ORF ( NP_061958.1, 365 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the Skp1-Cullin-F-box family of E3 ubiquitin ligases. The encoded protein is reported to bind to the transmembrane receptor interleukin 1 receptor-like 1 and regulate its ubiquitination and degradation. This protein has been linked to the regulation of pulmonary inflammation and psoriasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Molecular Mass: 37.62 kDa
• AA Sequence: RLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXL19 F-box and leucine rich repeat protein 19 [ Homo sapiens (human) ]
• Official Symbol: FBXL19
• Synonyms: FBXL19; F-box and leucine rich repeat protein 19; F-Box And Leucine Rich Repeat Protein 19; Jumonji C Domain-Containing Histone Demethylase 1C; Fbl19; F-Box And Leucine-Rich Repeat Protein 19; F-Box/LRR-Repeat Protein 19; CXXC11; JHDM1C; F-box/LRR-repeat protein 19; jumonji C domain-containing histone demethylase 1C
• Gene ID: 54620
• mRNA Refseq: NM_001099784
• Protein Refseq: NP_001093254
• MIM: 609085
• UniProt ID: Q6PCT2