Recombinant Human FBXL2 protein, His-tagged
Cat.No. : | FBXL2-3779H |
Product Overview : | Recombinant Human FBXL2 protein(341 - 423 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 341 - 423 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ERLRVLELDNCLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCCVIL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FBXL2 F-box and leucine-rich repeat protein 2 [ Homo sapiens ] |
Official Symbol | FBXL2 |
Synonyms | FBXL2; F-box and leucine-rich repeat protein 2; F-box/LRR-repeat protein 2; FBL2; FBL3; F-box protein FBL2/FBL3; F-box protein containing leucine-rich repeats; DKFZp564P0622; |
Gene ID | 25827 |
mRNA Refseq | NM_001171713 |
Protein Refseq | NP_001165184 |
MIM | 605652 |
UniProt ID | Q9UKC9 |
◆ Recombinant Proteins | ||
Fbxl2-2962M | Recombinant Mouse Fbxl2 Protein, Myc/DDK-tagged | +Inquiry |
FBXL2-3779H | Recombinant Human FBXL2 protein, His-tagged | +Inquiry |
FBXL2-1159H | Recombinant Human FBXL2 Protein (1-423 aa), His-SUMO-tagged | +Inquiry |
FBXL2-4964HF | Recombinant Full Length Human FBXL2 Protein, GST-tagged | +Inquiry |
FBXL2-961HFL | Recombinant Full Length Human FBXL2 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXL2 Products
Required fields are marked with *
My Review for All FBXL2 Products
Required fields are marked with *
0
Inquiry Basket