Recombinant Human FBXL2 protein, His-tagged
| Cat.No. : | FBXL2-3779H |
| Product Overview : | Recombinant Human FBXL2 protein(341 - 423 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 341 - 423 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ERLRVLELDNCLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCCVIL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FBXL2 F-box and leucine-rich repeat protein 2 [ Homo sapiens ] |
| Official Symbol | FBXL2 |
| Synonyms | FBXL2; F-box and leucine-rich repeat protein 2; F-box/LRR-repeat protein 2; FBL2; FBL3; F-box protein FBL2/FBL3; F-box protein containing leucine-rich repeats; DKFZp564P0622; |
| Gene ID | 25827 |
| mRNA Refseq | NM_001171713 |
| Protein Refseq | NP_001165184 |
| MIM | 605652 |
| UniProt ID | Q9UKC9 |
| ◆ Recombinant Proteins | ||
| FBXL2-2298H | Recombinant Human FBXL2 Protein (1-423 aa), His-tagged | +Inquiry |
| FBXL2-4964HF | Recombinant Full Length Human FBXL2 Protein, GST-tagged | +Inquiry |
| FBXL2-10458Z | Recombinant Zebrafish FBXL2 | +Inquiry |
| FBXL2-1159H | Recombinant Human FBXL2 Protein (1-423 aa), His-SUMO-tagged | +Inquiry |
| Fbxl2-2962M | Recombinant Mouse Fbxl2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXL2 Products
Required fields are marked with *
My Review for All FBXL2 Products
Required fields are marked with *
