Recombinant Human FBXL22 Protein, GST-tagged
Cat.No. : | FBXL22-3902H |
Product Overview : | Human FBXL22 full-length ORF (AAH65833.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the F-box protein family. This F-box protein interacts with S-phase kinase-associated protein 1A and cullin in order to form SCF complexes which function as ubiquitin ligases.[provided by RefSeq, Sep 2010] |
Molecular Mass : | 52.91 kDa |
AA Sequence : | MHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLSAVRSPRRREAPAPSSGTPIAVGPKSPRWGGPDHSEFADLRSGVTGARAAARRGLGSLRAERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXL22 F-box and leucine-rich repeat protein 22 [ Homo sapiens ] |
Official Symbol | FBXL22 |
Synonyms | FBXL22; F-box and leucine-rich repeat protein 22; F-box/LRR-repeat protein 22; Fbl22; FLJ39626; MGC75496; |
Gene ID | 283807 |
mRNA Refseq | NM_203373 |
Protein Refseq | NP_976307 |
MIM | 609088 |
UniProt ID | Q6P050 |
◆ Recombinant Proteins | ||
FBXL22-5722M | Recombinant Mouse FBXL22 Protein | +Inquiry |
FBXL22-2086Z | Recombinant Zebrafish FBXL22 | +Inquiry |
FBXL22-4989HF | Recombinant Full Length Human FBXL22 Protein, GST-tagged | +Inquiry |
FBXL22-3902H | Recombinant Human FBXL22 Protein, GST-tagged | +Inquiry |
FBXL22-3147M | Recombinant Mouse FBXL22 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXL22-6311HCL | Recombinant Human FBXL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXL22 Products
Required fields are marked with *
My Review for All FBXL22 Products
Required fields are marked with *
0
Inquiry Basket