Recombinant Human FBXO10 Protein, GST-tagged
Cat.No. : | FBXO10-3913H |
Product Overview : | Human FBXO10 partial ORF ( XP_291314, 863 a.a. - 962 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RAKALVQENIIFQGKTSKTIFQQISNNRECIMQNNKFLVFKKKSDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNRSVFCTIL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO10 F-box protein 10 [ Homo sapiens (human) ] |
Official Symbol | FBXO10 |
Synonyms | FBXO10; F-box protein 10; F-Box Protein 10; F-Box Only Protein 10; PRMT11; FBX10; F-Box Protein Fbx10; F-box only protein 10; F-box protein Fbx10 |
Gene ID | 26267 |
mRNA Refseq | NM_012166 |
Protein Refseq | NP_036298 |
MIM | 609092 |
UniProt ID | Q9UK96 |
◆ Recombinant Proteins | ||
FBXO10-3913H | Recombinant Human FBXO10 Protein, GST-tagged | +Inquiry |
FBXO10-5729M | Recombinant Mouse FBXO10 Protein | +Inquiry |
FBXO10-3152M | Recombinant Mouse FBXO10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO10 Products
Required fields are marked with *
My Review for All FBXO10 Products
Required fields are marked with *