Recombinant Human FBXO18 protein, His-tagged
| Cat.No. : | FBXO18-3911H |
| Product Overview : | Recombinant Human FBXO18 protein(281-492 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 281-492 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QENSCTQATKVKEEPSVWPGKKTIQLTHEQQLILNHKMEPLQVVKIMAFAGTGKTSTLVKYAEKWSQSRFLYVTFNKSIAKQAERVFPSNVICKTFHSMAYGHIGRKYQSKKKLNLFKLTPFMVNSVLAEGKGGFIRAKLVCKTLENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLNGVLEASRLWDNMRKLGECTEEAHQMTHDGY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FBXO18 F-box protein, helicase, 18 [ Homo sapiens ] |
| Official Symbol | FBXO18 |
| Synonyms | FBXO18; F-box protein, helicase, 18; F box only protein 18; F-box only protein 18; FBH1; Fbx18; FLJ14590; F-box DNA helicase 1; F-box only protein, helicase, 18; MGC131916; MGC141935; MGC141937; |
| Gene ID | 84893 |
| mRNA Refseq | NM_032807 |
| Protein Refseq | NP_116196 |
| MIM | 607222 |
| UniProt ID | Q8NFZ0 |
| ◆ Recombinant Proteins | ||
| FBXO18-28815TH | Recombinant Human FBXO18, His-tagged | +Inquiry |
| FBXO18-12787H | Recombinant Human FBXO18, His-tagged | +Inquiry |
| FBXO18-3911H | Recombinant Human FBXO18 protein, His-tagged | +Inquiry |
| FBXO18-3606C | Recombinant Chicken FBXO18 | +Inquiry |
| FBXO18-4182Z | Recombinant Zebrafish FBXO18 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO18 Products
Required fields are marked with *
My Review for All FBXO18 Products
Required fields are marked with *
