Recombinant Human FBXO31, His-tagged
| Cat.No. : | FBXO31-28814TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 298-539 of Human FBXO31 with an N terminal His tag. Predicted MWt: 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 298-539 a.a. |
| Description : | Members of the F-box protein family, such as FBXO31, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al. |
| Conjugation : | HIS |
| Tissue specificity : | Highly expressed in brain. Expressed at moderate levels in most tissues, except bone marrow. |
| Form : | Lyophilised:Reconstitute with 138 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNI PAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRE RVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPS KGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVG VSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILF DEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDE MLKNIQSLTS |
| Sequence Similarities : | Belongs to the FBXO31 family.Contains 1 F-box domain. |
| Gene Name | FBXO31 F-box protein 31 [ Homo sapiens ] |
| Official Symbol | FBXO31 |
| Synonyms | FBXO31; F-box protein 31; F box only protein 31; F-box only protein 31; FBX14; Fbx31; FBXO14; MGC15419; |
| Gene ID | 79791 |
| mRNA Refseq | NM_024735 |
| Protein Refseq | NP_079011 |
| MIM | 609102 |
| Uniprot ID | Q5XUX0 |
| Chromosome Location | 16q24 |
| Function | cyclin binding; |
| ◆ Recombinant Proteins | ||
| FBXO31-28814TH | Recombinant Human FBXO31, His-tagged | +Inquiry |
| FBXO31-1662R | Recombinant Rhesus monkey FBXO31 Protein, His-tagged | +Inquiry |
| FBXO31-5033HF | Recombinant Full Length Human FBXO31 Protein, GST-tagged | +Inquiry |
| FBXO31-4304H | Recombinant Human FBXO31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FBXO31-2294R | Recombinant Rat FBXO31 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXO31-6298HCL | Recombinant Human FBXO31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO31 Products
Required fields are marked with *
My Review for All FBXO31 Products
Required fields are marked with *
