Recombinant Human FBXO31, His-tagged
Cat.No. : | FBXO31-28814TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 298-539 of Human FBXO31 with an N terminal His tag. Predicted MWt: 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 298-539 a.a. |
Description : | Members of the F-box protein family, such as FBXO31, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al. |
Conjugation : | HIS |
Tissue specificity : | Highly expressed in brain. Expressed at moderate levels in most tissues, except bone marrow. |
Form : | Lyophilised:Reconstitute with 138 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNI PAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRE RVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPS KGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVG VSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILF DEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDE MLKNIQSLTS |
Sequence Similarities : | Belongs to the FBXO31 family.Contains 1 F-box domain. |
Gene Name | FBXO31 F-box protein 31 [ Homo sapiens ] |
Official Symbol | FBXO31 |
Synonyms | FBXO31; F-box protein 31; F box only protein 31; F-box only protein 31; FBX14; Fbx31; FBXO14; MGC15419; |
Gene ID | 79791 |
mRNA Refseq | NM_024735 |
Protein Refseq | NP_079011 |
MIM | 609102 |
Uniprot ID | Q5XUX0 |
Chromosome Location | 16q24 |
Function | cyclin binding; |
◆ Recombinant Proteins | ||
FBXO31-3934H | Recombinant Human FBXO31 Protein, GST-tagged | +Inquiry |
FBXO31-28814TH | Recombinant Human FBXO31, His-tagged | +Inquiry |
FBXO31-1486R | Recombinant Rhesus Macaque FBXO31 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO31-4304H | Recombinant Human FBXO31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Fbxo31-2967M | Recombinant Mouse Fbxo31 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO31-6298HCL | Recombinant Human FBXO31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXO31 Products
Required fields are marked with *
My Review for All FBXO31 Products
Required fields are marked with *
0
Inquiry Basket