Recombinant Human FBXO31 Protein, GST-tagged
| Cat.No. : | FBXO31-3934H |
| Product Overview : | Human FBXO31 full-length ORF ( AAH12748.1, 1 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the F-box family. Members are classified into three classes according to the substrate interaction domain, FBW for WD40 repeats, FBL for leucing-rich repeats, and FBXO for other domains. This protein, classified into the last category because of the lack of a recognizable substrate binding domain, has been proposed to be a component of the SCF ubiquitination complex. It is thought to bind and recruit substrate for ubiquitination and degradation. This protein may have a role in regulating the cell cycle as well as dendrite growth and neuronal migration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
| Molecular Mass : | 68.1 kDa |
| AA Sequence : | MYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBXO31 F-box only protein 31 [ Homo sapiens ] |
| Official Symbol | FBXO31 |
| Synonyms | FBXO31; F-box only protein 31; F box only protein 31; FBX14; Fbx31; FBXO14; MGC15419; |
| Gene ID | 79791 |
| mRNA Refseq | NM_001282683 |
| Protein Refseq | NP_001269612 |
| MIM | 609102 |
| UniProt ID | Q5XUX0 |
| ◆ Recombinant Proteins | ||
| FBXO31-2294R | Recombinant Rat FBXO31 Protein | +Inquiry |
| FBXO31-1486R | Recombinant Rhesus Macaque FBXO31 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FBXO31-4304H | Recombinant Human FBXO31 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FBXO31-5033HF | Recombinant Full Length Human FBXO31 Protein, GST-tagged | +Inquiry |
| FBXO31-3934H | Recombinant Human FBXO31 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXO31-6298HCL | Recombinant Human FBXO31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO31 Products
Required fields are marked with *
My Review for All FBXO31 Products
Required fields are marked with *
