Recombinant Human FBXO32
Cat.No. : | FBXO32-28812TH |
Product Overview : | Recombinant full length Human Fbx32 with a proprietary tag; Predicted MWt 49.21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 210 amino acids |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Weight : | 49.210kDa inclusive of tags |
Tissue specificity : | Specifically expressed in cardiac and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF |
Sequence Similarities : | Contains 1 F-box domain. |
Gene Name | FBXO32 F-box protein 32 [ Homo sapiens ] |
Official Symbol | FBXO32 |
Synonyms | FBXO32; F-box protein 32; F box only protein 32; F-box only protein 32; ATROGIN1; Fbx32; MAFbx; |
Gene ID | 114907 |
mRNA Refseq | NM_148177 |
Protein Refseq | NP_680482 |
MIM | 606604 |
Uniprot ID | Q969P5 |
Chromosome Location | 8q24.13 |
Pathway | FoxO family signaling, organism-specific biosystem; Monoamine Transport, organism-specific biosystem; |
◆ Recombinant Proteins | ||
FBXO32-3647H | Recombinant Human FBXO32 protein, His-tagged | +Inquiry |
FBXO32-1952R | Recombinant Rat FBXO32 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO32-237H | Recombinant Human FBXO32 Protein, His-tagged | +Inquiry |
FBXO32-28812TH | Recombinant Human FBXO32 | +Inquiry |
FBXO32-7843H | Recombinant Human FBXO32 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO32-6297HCL | Recombinant Human FBXO32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO32 Products
Required fields are marked with *
My Review for All FBXO32 Products
Required fields are marked with *
0
Inquiry Basket