Recombinant Human FBXO41 Protein, GST-tagged

Cat.No. : FBXO41-3948H
Product Overview : Human FBXO41 partial ORF ( XP_377742.2, 400 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the F-box protein family, which is characterized by an approximately 40 amino acid motif, the F-box. F-box proteins constitute one of the four subunits of the SCF ubiquitin protein ligase complex that plays a role in phosphorylation-dependent ubiquitination. F-box proteins are divided into three classes depending on the interaction substrate domain each contains in addition to the F-box motif: FBXW proteins contain WD-40 domains, FBXL proteins contain leucine-rich repeats, and FBXO proteins contain either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the FBXO class. [provided by RefSeq, Feb 2014]
Molecular Mass : 36.63 kDa
AA Sequence : DHVSEITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSSPEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXO41 F-box protein 41 [ Homo sapiens (human) ]
Official Symbol FBXO41
Synonyms FBXO41; F-box protein 41; F-Box Protein 41; FBX41; F-Box Only Protein 41; KIAA1940; F-box only protein 41
Gene ID 150726
mRNA Refseq NM_001080410
Protein Refseq NP_001073879
MIM 609108
UniProt ID Q8TF61

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXO41 Products

Required fields are marked with *

My Review for All FBXO41 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon