Recombinant Human FBXO41 Protein, GST-tagged
Cat.No. : | FBXO41-3948H |
Product Overview : | Human FBXO41 partial ORF ( XP_377742.2, 400 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the F-box protein family, which is characterized by an approximately 40 amino acid motif, the F-box. F-box proteins constitute one of the four subunits of the SCF ubiquitin protein ligase complex that plays a role in phosphorylation-dependent ubiquitination. F-box proteins are divided into three classes depending on the interaction substrate domain each contains in addition to the F-box motif: FBXW proteins contain WD-40 domains, FBXL proteins contain leucine-rich repeats, and FBXO proteins contain either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the FBXO class. [provided by RefSeq, Feb 2014] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | DHVSEITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSSPEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO41 F-box protein 41 [ Homo sapiens (human) ] |
Official Symbol | FBXO41 |
Synonyms | FBXO41; F-box protein 41; F-Box Protein 41; FBX41; F-Box Only Protein 41; KIAA1940; F-box only protein 41 |
Gene ID | 150726 |
mRNA Refseq | NM_001080410 |
Protein Refseq | NP_001073879 |
MIM | 609108 |
UniProt ID | Q8TF61 |
◆ Recombinant Proteins | ||
FBXO41-886H | Recombinant Human FBXO41 | +Inquiry |
FBXO41-3948H | Recombinant Human FBXO41 Protein, GST-tagged | +Inquiry |
FBXO41-2928H | Recombinant Human FBXO41 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO41 Products
Required fields are marked with *
My Review for All FBXO41 Products
Required fields are marked with *