Recombinant Human FBXO45 Protein, GST-tagged
Cat.No. : | FBXO45-3954H |
Product Overview : | Human FBXO45 partial ORF ( XP_117294.3, 39 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the F-box protein family, such as FBXO45, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (summary by Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Jan 2011] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | LPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO45 F-box protein 45 [ Homo sapiens ] |
Official Symbol | FBXO45 |
Synonyms | Fbx45 |
Gene ID | 200933 |
mRNA Refseq | NM_001105573 |
Protein Refseq | NP_001099043 |
MIM | 609112 |
UniProt ID | P0C2W1 |
◆ Recombinant Proteins | ||
FBXO45-3169M | Recombinant Mouse FBXO45 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO45-3954H | Recombinant Human FBXO45 Protein, GST-tagged | +Inquiry |
FBXO45-10873Z | Recombinant Zebrafish FBXO45 | +Inquiry |
FBXO45-5755M | Recombinant Mouse FBXO45 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXO45 Products
Required fields are marked with *
My Review for All FBXO45 Products
Required fields are marked with *
0
Inquiry Basket