Recombinant Human FBXO47 Protein, GST-tagged

Cat.No. : FBXO47-3956H
Product Overview : Human FBXO47 partial ORF ( NP_001008777, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FBXO47 (F-Box Protein 47) is a Protein Coding gene. Diseases associated with FBXO47 include Renal Cell Carcinoma, Papillary.
Molecular Mass : 36.63 kDa
AA Sequence : MASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEIFQIILKYLSVKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXO47 F-box protein 47 [ Homo sapiens (human) ]
Official Symbol FBXO47
Synonyms FBXO47; F-box protein 47; F-Box Protein 47; F-box only protein 47
Gene ID 494188
mRNA Refseq NM_001008777
Protein Refseq NP_001008777
MIM 609498
UniProt ID Q5MNV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXO47 Products

Required fields are marked with *

My Review for All FBXO47 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon