Recombinant Human FBXO47 Protein, GST-tagged
| Cat.No. : | FBXO47-3956H |
| Product Overview : | Human FBXO47 partial ORF ( NP_001008777, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FBXO47 (F-Box Protein 47) is a Protein Coding gene. Diseases associated with FBXO47 include Renal Cell Carcinoma, Papillary. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | MASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEIFQIILKYLSVKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHNL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FBXO47 F-box protein 47 [ Homo sapiens (human) ] |
| Official Symbol | FBXO47 |
| Synonyms | FBXO47; F-box protein 47; F-Box Protein 47; F-box only protein 47 |
| Gene ID | 494188 |
| mRNA Refseq | NM_001008777 |
| Protein Refseq | NP_001008777 |
| MIM | 609498 |
| UniProt ID | Q5MNV8 |
| ◆ Recombinant Proteins | ||
| FBXO47-3956H | Recombinant Human FBXO47 Protein, GST-tagged | +Inquiry |
| FBXO47-3171M | Recombinant Mouse FBXO47 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FBXO47-5757M | Recombinant Mouse FBXO47 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXO47 Products
Required fields are marked with *
My Review for All FBXO47 Products
Required fields are marked with *
