Recombinant Human FBXW11 protein, GST-tagged
| Cat.No. : | FBXW11-12808H |
| Product Overview : | Recombinant Human FBXW11 protein(216-529 aa), fused with GST tag, was expressed in E.coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 216-529 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | NLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FBXW11 F-box and WD repeat domain containing 11 [ Homo sapiens ] |
| Official Symbol | FBXW11 |
| Synonyms | FBXW11; F-box and WD repeat domain containing 11; F box and WD 40 domain protein 1B , F box and WD 40 domain protein 11 , FBXW1B; F-box/WD repeat-containing protein 11; BTRC2; BTRCP2; Fbw1b; Fbw11; Hos; KIAA0696; F-box protein Fbw1b; homologous to Slimb protein; F-box and WD-40 domain protein 11; F-box and WD-40 domain protein 1B; F-box/WD repeat-containing protein 1B; F-box and WD repeats protein beta-TrCP2; beta-transducin repeat-containing protein 2; FBW1B; FBXW1B; |
| Gene ID | 23291 |
| mRNA Refseq | NM_012300 |
| Protein Refseq | NP_036432 |
| MIM | 605651 |
| UniProt ID | Q9UKB1 |
| ◆ Recombinant Proteins | ||
| FBXW11-1670R | Recombinant Rhesus monkey FBXW11 Protein, His-tagged | +Inquiry |
| FBXW11-6433H | Recombinant Human FBXW11 protein, His&Myc-tagged | +Inquiry |
| FBXW11-14H | Recombinant Human FBXW11 Protein | +Inquiry |
| FBXW11-6063H | Recombinant Human FBXW11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Fbxw11-230M | Recombinant Mouse Fbxw11 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBXW11-6286HCL | Recombinant Human FBXW11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXW11 Products
Required fields are marked with *
My Review for All FBXW11 Products
Required fields are marked with *
