Recombinant Human FBXW11 protein, GST-tagged

Cat.No. : FBXW11-12808H
Product Overview : Recombinant Human FBXW11 protein(216-529 aa), fused with GST tag, was expressed in E.coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 216-529 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : NLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FBXW11 F-box and WD repeat domain containing 11 [ Homo sapiens ]
Official Symbol FBXW11
Synonyms FBXW11; F-box and WD repeat domain containing 11; F box and WD 40 domain protein 1B , F box and WD 40 domain protein 11 , FBXW1B; F-box/WD repeat-containing protein 11; BTRC2; BTRCP2; Fbw1b; Fbw11; Hos; KIAA0696; F-box protein Fbw1b; homologous to Slimb protein; F-box and WD-40 domain protein 11; F-box and WD-40 domain protein 1B; F-box/WD repeat-containing protein 1B; F-box and WD repeats protein beta-TrCP2; beta-transducin repeat-containing protein 2; FBW1B; FBXW1B;
Gene ID 23291
mRNA Refseq NM_012300
Protein Refseq NP_036432
MIM 605651
UniProt ID Q9UKB1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXW11 Products

Required fields are marked with *

My Review for All FBXW11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon