Recombinant Human FBXW11 protein, His&Myc-tagged
Cat.No. : | FBXW11-6433H |
Product Overview : | Recombinant Human FBXW11 protein(Q9UKB1)(1-542aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-542a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 69.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR |
Gene Name | FBXW11 F-box and WD repeat domain containing 11 [ Homo sapiens ] |
Official Symbol | FBXW11 |
Synonyms | FBXW11; F-box and WD repeat domain containing 11; F box and WD 40 domain protein 1B , F box and WD 40 domain protein 11 , FBXW1B; F-box/WD repeat-containing protein 11; BTRC2; BTRCP2; Fbw1b; Fbw11; Hos; KIAA0696; F-box protein Fbw1b; homologous to Slimb protein; F-box and WD-40 domain protein 11; F-box and WD-40 domain protein 1B; F-box/WD repeat-containing protein 1B; F-box and WD repeats protein beta-TrCP2; beta-transducin repeat-containing protein 2; FBW1B; FBXW1B; |
Gene ID | 23291 |
mRNA Refseq | NM_012300 |
Protein Refseq | NP_036432 |
MIM | 605651 |
UniProt ID | Q9UKB1 |
◆ Recombinant Proteins | ||
FBXW11-1494R | Recombinant Rhesus Macaque FBXW11 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXW11-12808H | Recombinant Human FBXW11 protein, GST-tagged | +Inquiry |
FBXW11-14H | Recombinant Human FBXW11 Protein | +Inquiry |
Fbxw11-230M | Recombinant Mouse Fbxw11 Protein, MYC/DDK-tagged | +Inquiry |
FBXW11-6063H | Recombinant Human FBXW11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXW11-6286HCL | Recombinant Human FBXW11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXW11 Products
Required fields are marked with *
My Review for All FBXW11 Products
Required fields are marked with *
0
Inquiry Basket