Recombinant Human FBXW8 Protein, GST-tagged
Cat.No. : | FBXW8-3977H |
Product Overview : | Human FBXW8 partial ORF ( NP_699179, 499 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXW8 F-box and WD repeat domain containing 8 [ Homo sapiens ] |
Official Symbol | FBXW8 |
Synonyms | FBXW8; F-box and WD repeat domain containing 8; F box and WD 40 domain protein 8 , F box only protein 29 , FBXO29; F-box/WD repeat-containing protein 8; FBW6; FBW8; FBX29; F-box only protein 29; F-box and WD-40 domain protein 8; F-box and WD-40 domain-containing protein 8; FBXW6; FBXO29; MGC33534; |
Gene ID | 26259 |
mRNA Refseq | NM_012174 |
Protein Refseq | NP_036306 |
MIM | 609073 |
UniProt ID | Q8N3Y1 |
◆ Recombinant Proteins | ||
FBXW8-3180M | Recombinant Mouse FBXW8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXW8-3977H | Recombinant Human FBXW8 Protein, GST-tagged | +Inquiry |
FBXW8-6446Z | Recombinant Zebrafish FBXW8 | +Inquiry |
FBXW8-5781M | Recombinant Mouse FBXW8 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBXW8 Products
Required fields are marked with *
My Review for All FBXW8 Products
Required fields are marked with *
0
Inquiry Basket