Recombinant Human FBXW8 Protein, GST-tagged

Cat.No. : FBXW8-3977H
Product Overview : Human FBXW8 partial ORF ( NP_699179, 499 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXW8 F-box and WD repeat domain containing 8 [ Homo sapiens ]
Official Symbol FBXW8
Synonyms FBXW8; F-box and WD repeat domain containing 8; F box and WD 40 domain protein 8 , F box only protein 29 , FBXO29; F-box/WD repeat-containing protein 8; FBW6; FBW8; FBX29; F-box only protein 29; F-box and WD-40 domain protein 8; F-box and WD-40 domain-containing protein 8; FBXW6; FBXO29; MGC33534;
Gene ID 26259
mRNA Refseq NM_012174
Protein Refseq NP_036306
MIM 609073
UniProt ID Q8N3Y1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBXW8 Products

Required fields are marked with *

My Review for All FBXW8 Products

Required fields are marked with *

0
cart-icon
0
compare icon