Recombinant Human FCAR Protein, GST-tagged

• Cat.No.: FCAR-3983H
• Product Overview: Human FCAR partial ORF ( AAH27953, 24 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: GDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCAR Fc fragment of IgA, receptor for [ Homo sapiens ]
• Official Symbol: FCAR
• Synonyms: FCAR; Fc fragment of IgA, receptor for; immunoglobulin alpha Fc receptor; CD89; IgA Fc receptor; Fc alpha receptor
• Gene ID: 2204
• mRNA Refseq: NM_002000
• Protein Refseq: NP_001991
• MIM: 147045
• UniProt ID: P24071