Recombinant Human FCAR Protein, GST-tagged
Cat.No. : | FCAR-3983H |
Product Overview : | Human FCAR partial ORF ( AAH27953, 24 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | GDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCAR Fc fragment of IgA, receptor for [ Homo sapiens ] |
Official Symbol | FCAR |
Synonyms | FCAR; Fc fragment of IgA, receptor for; immunoglobulin alpha Fc receptor; CD89; IgA Fc receptor; Fc alpha receptor; |
Gene ID | 2204 |
mRNA Refseq | NM_002000 |
Protein Refseq | NP_001991 |
MIM | 147045 |
UniProt ID | P24071 |
◆ Recombinant Proteins | ||
FCAR-151H | Recombinant Human FCAR Protein, His-tagged | +Inquiry |
FCAR-6909H | Recombinant Human FCAR protein, His & GST-tagged | +Inquiry |
FCAR-213H | Recombinant Human FCAR Protein, His-tagged | +Inquiry |
FCAR-459H | Active Recombinant Human FCAR Protein, hFc-tagged | +Inquiry |
FCAR-4105H | Recombinant Human FCAR Protein (Met1-Asn227), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCAR-1929RCL | Recombinant Rat FCAR cell lysate | +Inquiry |
FCAR-3040HCL | Recombinant Human FCAR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCAR Products
Required fields are marked with *
My Review for All FCAR Products
Required fields are marked with *
0
Inquiry Basket