Recombinant Human FCER1G protein, His-B2M-tagged
Cat.No. : | FCER1G-2891H |
Product Overview : | Recombinant Human FCER1G protein(P30273)(45-86aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His-B2M |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.9 kDa |
Protein length : | 45-86aa |
AA Sequence : | RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name : | FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [ Homo sapiens ] |
Official Symbol : | FCER1G |
Synonyms : | FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG; |
Gene ID : | 2207 |
mRNA Refseq : | NM_004106 |
Protein Refseq : | NP_004097 |
MIM : | 147139 |
UniProt ID : | P30273 |
Products Types
◆ Recombinant Protein | ||
Fcer1g-1026M | Recombinant Mouse Fcer1g Protein, MYC/DDK-tagged | +Inquiry |
FCER1G-3182M | Recombinant Mouse FCER1G Protein, His (Fc)-Avi-tagged | +Inquiry |
FCER1G-1395H | Recombinant Human FCER1G Protein (45-86 aa), His-tagged | +Inquiry |
FCER1G-5785M | Recombinant Mouse FCER1G Protein | +Inquiry |
FCER1G-12816H | Recombinant Human FCER1G, GST-tagged | +Inquiry |
◆ Lysates | ||
FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket