Recombinant Human FCER1G protein, His-B2M-tagged
| Cat.No. : | FCER1G-2891H |
| Product Overview : | Recombinant Human FCER1G protein(P30273)(45-86aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 45-86aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.9 kDa |
| AA Sequence : | RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [ Homo sapiens ] |
| Official Symbol | FCER1G |
| Synonyms | FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG; |
| Gene ID | 2207 |
| mRNA Refseq | NM_004106 |
| Protein Refseq | NP_004097 |
| MIM | 147139 |
| UniProt ID | P30273 |
| ◆ Recombinant Proteins | ||
| Fcer1g-1026M | Recombinant Mouse Fcer1g Protein, MYC/DDK-tagged | +Inquiry |
| FCER1G-2891H | Recombinant Human FCER1G protein, His-B2M-tagged | +Inquiry |
| FCER1G-5499HFL | Recombinant Full Length Human FCER1G, Flag-tagged | +Inquiry |
| FCER1G-196H | Recombinant Human FCER1G, GST-tagged | +Inquiry |
| FCER1G-3182M | Recombinant Mouse FCER1G Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1G Products
Required fields are marked with *
My Review for All FCER1G Products
Required fields are marked with *




