Recombinant Human FCER1G Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FCER1G-3843H |
Product Overview : | FCER1G MS Standard C13 and N15-labeled recombinant protein (NP_004097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. |
Molecular Mass : | 9.67 kDa |
AA Sequence : | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FCER1G Fc fragment of IgE receptor Ig [ Homo sapiens (human) ] |
Official Symbol | FCER1G |
Synonyms | FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG; |
Gene ID | 2207 |
mRNA Refseq | NM_004106 |
Protein Refseq | NP_004097 |
MIM | 147139 |
UniProt ID | P30273 |
◆ Recombinant Proteins | ||
FCER1G-5785M | Recombinant Mouse FCER1G Protein | +Inquiry |
FCER1G-197H | Recombinant Human FCER1G, MYC/DDK-tagged | +Inquiry |
FCER1G-2891H | Recombinant Human FCER1G protein, His-B2M-tagged | +Inquiry |
Fcer1g-1026M | Recombinant Mouse Fcer1g Protein, MYC/DDK-tagged | +Inquiry |
FCER1G-1395H | Recombinant Human FCER1G Protein (45-86 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCER1G Products
Required fields are marked with *
My Review for All FCER1G Products
Required fields are marked with *
0
Inquiry Basket