Recombinant Human FCER1G Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FCER1G-3843H |
| Product Overview : | FCER1G MS Standard C13 and N15-labeled recombinant protein (NP_004097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. |
| Molecular Mass : | 9.67 kDa |
| AA Sequence : | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FCER1G Fc fragment of IgE receptor Ig [ Homo sapiens (human) ] |
| Official Symbol | FCER1G |
| Synonyms | FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG; |
| Gene ID | 2207 |
| mRNA Refseq | NM_004106 |
| Protein Refseq | NP_004097 |
| MIM | 147139 |
| UniProt ID | P30273 |
| ◆ Recombinant Proteins | ||
| FCER1G-2891H | Recombinant Human FCER1G protein, His-B2M-tagged | +Inquiry |
| FCER1G-12816H | Recombinant Human FCER1G, GST-tagged | +Inquiry |
| FCER1G-5499HFL | Recombinant Full Length Human FCER1G, Flag-tagged | +Inquiry |
| RFL11405RF | Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma(Fcer1G) Protein, His-Tagged | +Inquiry |
| FCER1G-5876Z | Recombinant Zebrafish FCER1G | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER1G Products
Required fields are marked with *
My Review for All FCER1G Products
Required fields are marked with *




