Recombinant Human FCF1 Protein, GST-tagged
Cat.No. : | FCF1-3986H |
Product Overview : | Human FCF1 full-length ORF (BAF83355.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FCF1 (FCF1 RRNA-Processing Protein) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include poly(A) RNA binding. |
Molecular Mass : | 48.18 kDa |
AA Sequence : | MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCF1 FCF1 small subunit (SSU) processome component homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | FCF1 |
Synonyms | Bka; UTP24; CGI-35; C14orf111; FCF1 RRNA-Processing Protein; FCF1 Small Subunit (SSU) Processome Component Homolog (S. Cerevisiae); Chromosome 14 Open Reading Frame 111; RNA-Processing Protein FCF1 Homolog; FCF1 Small Subunit; CGI-35; UTP24; Bka |
Gene ID | 51077 |
mRNA Refseq | NM_015962 |
Protein Refseq | NP_057046 |
UniProt ID | Q9Y324 |
◆ Recombinant Proteins | ||
FCF1-5787M | Recombinant Mouse FCF1 Protein | +Inquiry |
FCF1-2375Z | Recombinant Zebrafish FCF1 | +Inquiry |
FCF1-3184M | Recombinant Mouse FCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCF1-1497R | Recombinant Rhesus Macaque FCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCF1-1673R | Recombinant Rhesus monkey FCF1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCF1-6280HCL | Recombinant Human FCF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCF1 Products
Required fields are marked with *
My Review for All FCF1 Products
Required fields are marked with *