Recombinant Human FCGR1A, Fc-tagged

Cat.No. : FCGR1A-27573TH
Product Overview : Recombinant fragment corresponding to aa 16 - 115 of Human FCGR1A with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Fc
Protein Length : 100 amino acids
Description : This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1.
Conjugation : Fc
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Monocyte/macrophage specific.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT
Sequence Similarities : Belongs to the immunoglobulin superfamily. FCGR1 family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name FCGR1A Fc fragment of IgG, high affinity Ia, receptor (CD64) [ Homo sapiens ]
Official Symbol FCGR1A
Synonyms FCGR1A; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); high affinity immunoglobulin gamma Fc receptor I; CD64; CD64A;
Gene ID 2209
mRNA Refseq NM_000566
Protein Refseq NP_000557
MIM 146760
Uniprot ID P12314
Chromosome Location 1q21.2-q21.3
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Cross-presentation of soluble exogenous antigens (endosomes), organism-specific biosystem;
Function IgG binding; protein binding; receptor activity; receptor signaling protein activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR1A Products

Required fields are marked with *

My Review for All FCGR1A Products

Required fields are marked with *

0
cart-icon