Recombinant Human FCGR1A, Fc-tagged
Cat.No. : | FCGR1A-27573TH |
Product Overview : | Recombinant fragment corresponding to aa 16 - 115 of Human FCGR1A with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Fc |
Protein Length : | 100 amino acids |
Description : | This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. |
Conjugation : | Fc |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Monocyte/macrophage specific. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT |
Sequence Similarities : | Belongs to the immunoglobulin superfamily. FCGR1 family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains. |
Gene Name | FCGR1A Fc fragment of IgG, high affinity Ia, receptor (CD64) [ Homo sapiens ] |
Official Symbol | FCGR1A |
Synonyms | FCGR1A; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); high affinity immunoglobulin gamma Fc receptor I; CD64; CD64A; |
Gene ID | 2209 |
mRNA Refseq | NM_000566 |
Protein Refseq | NP_000557 |
MIM | 146760 |
Uniprot ID | P12314 |
Chromosome Location | 1q21.2-q21.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Cross-presentation of soluble exogenous antigens (endosomes), organism-specific biosystem; |
Function | IgG binding; protein binding; receptor activity; receptor signaling protein activity; |
◆ Recombinant Proteins | ||
FCGR1A-3818H | Recombinant Human Fc Fragment Of IgG, High Affinity Ia, Receptor (CD64), AVI-tagged | +Inquiry |
FCGR1A-2454H | Recombinant Human FCGR1A Protein (Gln16-Pro288), C-His tagged | +Inquiry |
RFL2641HF | Recombinant Full Length Human High Affinity Immunoglobulin Gamma Fc Receptor I(Fcgr1A) Protein, His-Tagged | +Inquiry |
FCGR1A-540H | Recombinant Human FCGR1A Protein | +Inquiry |
FCGR1A-179H | Active Recombinant Human FCGR1A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR1-1972RCL | Recombinant Rat FCGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR1A Products
Required fields are marked with *
My Review for All FCGR1A Products
Required fields are marked with *
0
Inquiry Basket