Recombinant Human FCGR1A, Fc-tagged
| Cat.No. : | FCGR1A-27573TH |
| Product Overview : | Recombinant fragment corresponding to aa 16 - 115 of Human FCGR1A with an N terminal proprietary tag; predicted mwt: 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Fc |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. |
| Conjugation : | Fc |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Monocyte/macrophage specific. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT |
| Sequence Similarities : | Belongs to the immunoglobulin superfamily. FCGR1 family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains. |
| Gene Name | FCGR1A Fc fragment of IgG, high affinity Ia, receptor (CD64) [ Homo sapiens ] |
| Official Symbol | FCGR1A |
| Synonyms | FCGR1A; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); high affinity immunoglobulin gamma Fc receptor I; CD64; CD64A; |
| Gene ID | 2209 |
| mRNA Refseq | NM_000566 |
| Protein Refseq | NP_000557 |
| MIM | 146760 |
| Uniprot ID | P12314 |
| Chromosome Location | 1q21.2-q21.3 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing-Cross presentation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Cross-presentation of soluble exogenous antigens (endosomes), organism-specific biosystem; |
| Function | IgG binding; protein binding; receptor activity; receptor signaling protein activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR1A Products
Required fields are marked with *
My Review for All FCGR1A Products
Required fields are marked with *



