Recombinant Human FCGR1A protein, GST-tagged

Cat.No. : FCGR1A-301311H
Product Overview : Recombinant Human FCGR1A (311-374 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Val311-Thr374
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name FCGR1A Fc fragment of IgG, high affinity Ia, receptor (CD64) [ Homo sapiens ]
Official Symbol FCGR1A
Synonyms FCGR1A; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); high affinity immunoglobulin gamma Fc receptor I; CD64; CD64A; fcgammaRIa; Fc-gamma RI; fc-gamma RIA; Fc gamma receptor; IgG Fc receptor I; Fc-gamma receptor I A1; FCRI; IGFR1; FLJ18345;
Gene ID 2209
mRNA Refseq NM_000566
Protein Refseq NP_000557
MIM 146760
UniProt ID P12314

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR1A Products

Required fields are marked with *

My Review for All FCGR1A Products

Required fields are marked with *

0
cart-icon
0
compare icon