Recombinant Human FCGR1A protein, GST-tagged
| Cat.No. : | FCGR1A-301311H |
| Product Overview : | Recombinant Human FCGR1A (311-374 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Val311-Thr374 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | FCGR1A Fc fragment of IgG, high affinity Ia, receptor (CD64) [ Homo sapiens ] |
| Official Symbol | FCGR1A |
| Synonyms | FCGR1A; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); high affinity immunoglobulin gamma Fc receptor I; CD64; CD64A; fcgammaRIa; Fc-gamma RI; fc-gamma RIA; Fc gamma receptor; IgG Fc receptor I; Fc-gamma receptor I A1; FCRI; IGFR1; FLJ18345; |
| Gene ID | 2209 |
| mRNA Refseq | NM_000566 |
| Protein Refseq | NP_000557 |
| MIM | 146760 |
| UniProt ID | P12314 |
| ◆ Recombinant Proteins | ||
| FCGR1A-3988H | Recombinant Human FCGR1A Protein, GST-tagged | +Inquiry |
| FCGR1A-4107H | Recombinant Human FCGR1A Protein (Met1-Pro288), C-His tagged | +Inquiry |
| FCGR1A-1800R | Recombinant Rhesus Monkey FCGR1A Protein, mIgG2a-tagged | +Inquiry |
| FCGR1A-179H | Active Recombinant Human FCGR1A, His-tagged | +Inquiry |
| FCGR1A-12818H | Recombinant Human FCGR1A, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGR1-1972RCL | Recombinant Rat FCGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR1A Products
Required fields are marked with *
My Review for All FCGR1A Products
Required fields are marked with *
