Recombinant Human FCGR2A Protein, GST-tagged
Cat.No. : | FCGR2A-3992H |
Product Overview : | Human FCGR2A partial ORF ( AAH20823, 46 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 37.29 kDa |
AA Sequence : | PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCGR2A Fc fragment of IgG, low affinity IIa, receptor (CD32) [ Homo sapiens ] |
Official Symbol | FCGR2A |
Synonyms | FCGR2A; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32) , FCG2, FCGR2, FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; CD32; CD32A; CDw32; IGFR2; Immunoglobulin G Fc receptor II; fcRII-a; fc-gamma-RIIa; fc-gamma RII-a; igG Fc receptor II-a; FCG2; FcGR; FCGR2; FCGR2A1; MGC23887; MGC30032; |
Gene ID | 2212 |
mRNA Refseq | NM_001136219 |
Protein Refseq | NP_001129691 |
MIM | 146790 |
UniProt ID | P12318 |
◆ Recombinant Proteins | ||
FCGR2A-4107C | Recombinant Cynomolgus FCGR2A protein(Met1-Ile211), His-tagged | +Inquiry |
FCGR2A-513HB | Recombinant Human FCGR2A protein(F176), His-Avi-tagged, Biotinylated | +Inquiry |
FCGR2A-519C | Recombinant Cynomolgus FCGR2A Protein, His-tagged | +Inquiry |
FCGR2A-297C | Active Recombinant Cynomolgus FCGR2A protein, His/Avi-tagged, Biotinylated | +Inquiry |
FCGR2A-1962R | Recombinant Rat FCGR2A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FCGR2A-03H | Active Recombinant Human FCGR2A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
FCGR2A-678HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-1996HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-001HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR2A Products
Required fields are marked with *
My Review for All FCGR2A Products
Required fields are marked with *