Recombinant Human FCGR2A protein, His-tagged
Cat.No. : | FCGR2A-4676H |
Product Overview : | Recombinant Human FCGR2A protein(P12318)(34-217 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 34-217 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 22.4 kDa |
AASequence : | QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | FCGR2A Fc fragment of IgG, low affinity IIa, receptor (CD32) [ Homo sapiens ] |
Official Symbol | FCGR2A |
Synonyms | FCGR2A; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32) , FCG2, FCGR2, FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; CD32; CD32A; CDw32; IGFR2; Immunoglobulin G Fc receptor II; fcRII-a; fc-gamma-RIIa; fc-gamma RII-a; igG Fc receptor II-a; FCG2; FcGR; FCGR2; FCGR2A1; MGC23887; MGC30032; |
Gene ID | 2212 |
mRNA Refseq | NM_001136219 |
Protein Refseq | NP_001129691 |
MIM | 146790 |
UniProt ID | P12318 |
◆ Recombinant Proteins | ||
FCGR2A-519C | Recombinant Cynomolgus FCGR2A Protein, His-tagged | +Inquiry |
FCGR2A-542H | Recombinant Human FCGR2A Protein (R167) | +Inquiry |
FCGR2A-899H | Recombinant Human FCGR2A Protein, His (Fc)-Avi-tagged | +Inquiry |
FCGR2A-1136H | Recombinant Human FCGR2A, His & AVI tagged | +Inquiry |
FCGR2A-270C | Active Recombinant Cynomolgus Monkey FCGR2A protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FCGR2A-03H | Active Recombinant Human FCGR2A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
FCGR2A-678HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-1996HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-001HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR2A Products
Required fields are marked with *
My Review for All FCGR2A Products
Required fields are marked with *