Recombinant Human FCGR2A protein, His-tagged

Cat.No. : FCGR2A-4676H
Product Overview : Recombinant Human FCGR2A protein(P12318)(34-217 aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 34-217 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 22.4 kDa
AASequence : QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name FCGR2A Fc fragment of IgG, low affinity IIa, receptor (CD32) [ Homo sapiens ]
Official Symbol FCGR2A
Synonyms FCGR2A; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32) , FCG2, FCGR2, FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; CD32; CD32A; CDw32; IGFR2; Immunoglobulin G Fc receptor II; fcRII-a; fc-gamma-RIIa; fc-gamma RII-a; igG Fc receptor II-a; FCG2; FcGR; FCGR2; FCGR2A1; MGC23887; MGC30032;
Gene ID 2212
mRNA Refseq NM_001136219
Protein Refseq NP_001129691
MIM 146790
UniProt ID P12318

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR2A Products

Required fields are marked with *

My Review for All FCGR2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon