Recombinant Human FCGR2B protein, Myc/DDK-tagged
Cat.No. : | FCGR2B-02H |
Product Overview : | Recombinant Human FCGR2B protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: ES Cell Differentiation/IPS, Transmembrane. Protein Pathways: B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. |
Source : | HEK293T |
Species : | Human |
Tag : | Myc/DDK |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.8 kDa |
AA Sequence : | myc-FLAG tag |
Product-Related Proteins : | TA50011-100 LC400365 TA349972 C204496 |
Purity : | > 80% |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name : | FCGR2B Fc gamma receptor IIb [ Homo sapiens (human) ] |
Official Symbol : | FCGR2B |
Synonyms : | CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2 |
Gene ID : | 2213 |
mRNA Refseq : | NM_001002275 |
Protein Refseq : | NP_001002275 |
MIM : | 604590 |
UniProt ID : | P31994 |
Products Types
◆ Recombinant Protein | ||
FCGR2B-545H | Recombinant Human FCGR2B Protein | +Inquiry |
FCGR2B-323H | Active Recombinant Human FCGR2B Protein, His & Avi-tagged, Biotinylated | +Inquiry |
FCGR2B-1499R | Recombinant Rhesus Macaque FCGR2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Fcgr2b-4083R | Recombinant Rat Fcgr2b protein(His 32 - Pro 212), His-tagged | +Inquiry |
FCGR2B-2971C | Recombinant Cynomolgus FCGR2B protein, His/AVI-tagged | +Inquiry |
◆ Lysates | ||
FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
FCGR2B-1942RCL | Recombinant Rat FCGR2B cell lysate | +Inquiry |
FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket