Recombinant Human FCGR2B protein, Myc/DDK-tagged
| Cat.No. : | FCGR2B-02H |
| Product Overview : | Recombinant Human FCGR2B protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: ES Cell Differentiation/IPS, Transmembrane. Protein Pathways: B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. |
| Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 33.8 kDa |
| AA Sequence : | myc-FLAG tag |
| Product-Related Proteins : | TA50011-100 LC400365 TA349972 C204496 |
| Purity : | > 80% |
| Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL |
| Gene Name | FCGR2B Fc gamma receptor IIb [ Homo sapiens (human) ] |
| Official Symbol | FCGR2B |
| Synonyms | CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2 |
| Gene ID | 2213 |
| mRNA Refseq | NM_001002275 |
| Protein Refseq | NP_001002275 |
| MIM | 604590 |
| UniProt ID | P31994 |
| ◆ Recombinant Proteins | ||
| FCGR2B-324H | Active Recombinant Human FCGR2B Protein, His & Avi-tagged, Biotinylated | +Inquiry |
| FCGR2B-1439R | Active Recombinant Rat FCGR2B protein, His-tagged | +Inquiry |
| FCGR2B-2972C | Active Recombinant Cynomolgus FCGR2B protein, His-Avi-tagged, Biotinylated | +Inquiry |
| FCGR2B-291C | Active Recombinant Cynomolgus FCGR2B protein, His/Avi-tagged, Biotinylated | +Inquiry |
| FCGR2B-258H | Recombinant Human FCGR2B, His-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
| FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
| FCGR2B-1942RCL | Recombinant Rat FCGR2B cell lysate | +Inquiry |
| FCGR2B-001HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR2B Products
Required fields are marked with *
My Review for All FCGR2B Products
Required fields are marked with *
