Recombinant Human FCGR2B protein, Myc/DDK-tagged

Cat.No. : FCGR2B-02H
Product Overview : Recombinant Human FCGR2B protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: ES Cell Differentiation/IPS, Transmembrane. Protein Pathways: B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene.
Form : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 33.8 kDa
AA Sequence : myc-FLAG tag
Product-Related Proteins : TA50011-100
LC400365
TA349972
C204496
Purity : > 80%
Usage : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL
Gene Name FCGR2B Fc gamma receptor IIb [ Homo sapiens (human) ]
Official Symbol FCGR2B
Synonyms CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2
Gene ID 2213
mRNA Refseq NM_001002275
Protein Refseq NP_001002275
MIM 604590
UniProt ID P31994

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCGR2B Products

Required fields are marked with *

My Review for All FCGR2B Products

Required fields are marked with *

0
cart-icon
0
compare icon