Recombinant Human FCGRT Protein, GST-tagged
| Cat.No. : | FCGRT-3998H |
| Product Overview : | Human FCGRT partial ORF ( AAH08734, 51 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ] |
| Official Symbol | FCGRT |
| Synonyms | FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain; |
| Gene ID | 2217 |
| mRNA Refseq | NM_001136019 |
| Protein Refseq | NP_001129491 |
| MIM | 601437 |
| UniProt ID | P55899 |
| ◆ Recombinant Proteins | ||
| FCGRT-5402H | Recombinant Human FCGRT protein, His-tagged | +Inquiry |
| Fcgrt-291M | Active Recombinant Mouse Fcgrt, His-tagged | +Inquiry |
| FCGRT-1629H | Recombinant Human FCGRT protein, His & T7-tagged | +Inquiry |
| Fcgrt-3188M | Recombinant Mouse Fcgrt Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fcgrt & B2m-1546M | Recombinant Mouse Fcgrt/B2m protein, His/Strep II/Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGRT Products
Required fields are marked with *
My Review for All FCGRT Products
Required fields are marked with *



