Recombinant Human FCGRT Protein, GST-tagged
Cat.No. : | FCGRT-3998H |
Product Overview : | Human FCGRT partial ORF ( AAH08734, 51 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ] |
Official Symbol | FCGRT |
Synonyms | FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain; |
Gene ID | 2217 |
mRNA Refseq | NM_001136019 |
Protein Refseq | NP_001129491 |
MIM | 601437 |
UniProt ID | P55899 |
◆ Recombinant Proteins | ||
Fcgrt-5665M | Recombinant Mouse Fcgrt Protein (Ser22-Val301, Ile21-Met119), C-His tagged | +Inquiry |
Fcgrt-291M | Active Recombinant Mouse Fcgrt, His-tagged | +Inquiry |
FCGRT-376H | Recombinant Human FCGRT Protein, AVI-tagged | +Inquiry |
Fcgrt & B2m-1546M | Recombinant Mouse Fcgrt/B2m protein, His/Strep II/Avi-tagged, Biotinylated | +Inquiry |
Fcgrt-491M | Active Recombinant Mouse Fc Receptor, LgG, Alpha Chain Transporter, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGRT Products
Required fields are marked with *
My Review for All FCGRT Products
Required fields are marked with *
0
Inquiry Basket