Recombinant Human FCMR Protein, His tagged
| Cat.No. : | FCMR-001H |
| Product Overview : | Recombinant Human FCMR Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 17-249 aa |
| Description : | Fc receptors specifically bind to the Fc region of immunoglobulins (Igs) to mediate the unique functions of each Ig class. FAIM3 encodes an Fc receptor for IgM. |
| Form : | Sterile PBS, pH7.4, 0.1% SKL |
| Molecular Mass : | 27 kDa |
| AASequence : | MHHHHHHHHHHLRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREG |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 85% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | FCMR Fc mu receptor [ Homo sapiens (human) ] |
| Official Symbol | FCMR |
| Synonyms | FCMR; Fc mu receptor; TOSO; FAIM3; FcmuR; IgM FcR |
| Gene ID | 9214 |
| mRNA Refseq | NM_005449 |
| Protein Refseq | NP_005440 |
| MIM | 606015 |
| UniProt ID | O60667 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCMR Products
Required fields are marked with *
My Review for All FCMR Products
Required fields are marked with *



