Recombinant Human FCMR Protein, His tagged

Cat.No. : FCMR-001H
Product Overview : Recombinant Human FCMR Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 17-249 aa
Description : Fc receptors specifically bind to the Fc region of immunoglobulins (Igs) to mediate the unique functions of each Ig class. FAIM3 encodes an Fc receptor for IgM.
Form : Sterile PBS, pH7.4, 0.1% SKL
Molecular Mass : 27 kDa
AASequence : MHHHHHHHHHHLRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREG
Endotoxin : < 1 EU/μg by LAL
Purity : > 85% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by BCA
Gene Name FCMR Fc mu receptor [ Homo sapiens (human) ]
Official Symbol FCMR
Synonyms FCMR; Fc mu receptor; TOSO; FAIM3; FcmuR; IgM FcR
Gene ID 9214
mRNA Refseq NM_005449
Protein Refseq NP_005440
MIM 606015
UniProt ID O60667

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCMR Products

Required fields are marked with *

My Review for All FCMR Products

Required fields are marked with *

0
cart-icon
0
compare icon