Recombinant Human FCMR Protein, His tagged

• Cat.No.: FCMR-001H
• Product Overview: Recombinant Human FCMR Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 17-249 aa
• Description: Fc receptors specifically bind to the Fc region of immunoglobulins (Igs) to mediate the unique functions of each Ig class. FAIM3 encodes an Fc receptor for IgM.
• Form: Sterile PBS, pH7.4, 0.1% SKL
• Molecular Mass: 27 kDa
• AASequence: MHHHHHHHHHHLRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREG
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 85% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: FCMR Fc mu receptor [ Homo sapiens (human) ]
• Official Symbol: FCMR
• Synonyms: FCMR; Fc mu receptor; TOSO; FAIM3; FcmuR; IgM FcR
• Gene ID: 9214
• mRNA Refseq: NM_005449
• Protein Refseq: NP_005440
• MIM: 606015
• UniProt ID: O60667