Recombinant Mouse FCMR Protein, His tagged

• Cat.No.: Fcmr-12M
• Product Overview: Recombinant Mouse FCMR Protein with His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Description: Predicted to enable transmembrane signaling receptor activity. Acts upstream of or within inhibition of cysteine-type endopeptidase activity involved in apoptotic process; negative regulation of extrinsic apoptotic signaling pathway; and negative regulation of lymphocyte apoptotic process. Located in external side of plasma membrane. Orthologous to human FCMR (Fc fragment of IgM receptor).
• Molecular Mass: 28.7 kDa
• AA Sequence: Signal peptide(19aa)+
  RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPEHHHHHH
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.2 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
• Storage Buffer: Liquid in sterile PBS, pH 8.0.

Gene Information

• Gene Name: Fcmr Fc fragment of IgM receptor [ Mus musculus (house mouse) ]
• Official Symbol: Fcmr
• Synonyms: Fcmr; Fc fragment of IgM receptor; Toso; Faim3; FcmuR; 1810037B05Rik; fas apoptotic inhibitory molecule 3; IgM Fc fragment receptor; regulator of Fas-induced apoptosis Toso
• Gene ID: 69169
• mRNA Refseq: NM_026976
• Protein Refseq: NP_081252
• UniProt ID: A1KXC4