Recombinant Mouse FCMR Protein, His tagged
Cat.No. : | Fcmr-12M |
Product Overview : | Recombinant Mouse FCMR Protein with His tag was expressed in HEK293. |
Availability | July 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Description : | Predicted to enable transmembrane signaling receptor activity. Acts upstream of or within inhibition of cysteine-type endopeptidase activity involved in apoptotic process; negative regulation of extrinsic apoptotic signaling pathway; and negative regulation of lymphocyte apoptotic process. Located in external side of plasma membrane. Orthologous to human FCMR (Fc fragment of IgM receptor). |
Molecular Mass : | 28.7 kDa |
AA Sequence : | Signal peptide(19aa)+ RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPEHHHHHH |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.2 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
Storage Buffer : | Liquid in sterile PBS, pH 8.0. |
Gene Name | Fcmr Fc fragment of IgM receptor [ Mus musculus (house mouse) ] |
Official Symbol | Fcmr |
Synonyms | Fcmr; Fc fragment of IgM receptor; Toso; Faim3; FcmuR; 1810037B05Rik; fas apoptotic inhibitory molecule 3; IgM Fc fragment receptor; regulator of Fas-induced apoptosis Toso |
Gene ID | 69169 |
mRNA Refseq | NM_026976 |
Protein Refseq | NP_081252 |
UniProt ID | A1KXC4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fcmr Products
Required fields are marked with *
My Review for All Fcmr Products
Required fields are marked with *