Recombinant Human FCRLA protein, His-tagged
Cat.No. : | FCRLA-3756H |
Product Overview : | Recombinant Human FCRLA protein(275-376 aa), fused to His tag, was expressed in E. coli. |
Availability | August 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 275-376 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IRVQGASSSAAPPTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHQKPGTTKATAE |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FCRLA Fc receptor-like A [ Homo sapiens ] |
Official Symbol | FCRLA |
Synonyms | FCRLA; Fc receptor-like A; Fc receptor like and mucin like 1 , FCRLM1; FCRL; FCRLa; FCRLb; FCRLc1; FCRLc2; FCRLd; FCRLe; FCRLX; FREB; MGC4595; fc receptor-like protein; Fc receptor related protein X; fc receptor-related protein X; Fc receptor-like and mucin-like 1; fc receptor homolog expressed in B-cells; fc receptor-like and mucin-like protein 1; Fc receptor homolog expressed in B cells (FREB); FCRX; FCRL1; FCRLM1; RP11-474I16.5; |
Gene ID | 84824 |
mRNA Refseq | NM_001184866 |
Protein Refseq | NP_001171795 |
MIM | 606891 |
UniProt ID | Q7L513 |
◆ Recombinant Proteins | ||
FCRLA-2368H | Recombinant Human FCRLA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FCRLA-5800M | Recombinant Mouse FCRLA Protein | +Inquiry |
FCRLA-4013H | Recombinant Human FCRLA Protein, GST-tagged | +Inquiry |
FCRLA-4784HF | Recombinant Full Length Human FCRLA Protein, GST-tagged | +Inquiry |
FCRLA-3756H | Recombinant Human FCRLA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCRLA-6273HCL | Recombinant Human FCRLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCRLA Products
Required fields are marked with *
My Review for All FCRLA Products
Required fields are marked with *