Recombinant Human FCRLA protein, His-tagged

• Cat.No.: FCRLA-3756H
• Product Overview: Recombinant Human FCRLA protein(275-376 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 275-376 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: IRVQGASSSAAPPTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHQKPGTTKATAE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: FCRLA Fc receptor-like A [ Homo sapiens ]
• Official Symbol: FCRLA
• Synonyms: FCRLA; Fc receptor-like A; Fc receptor like and mucin like 1 , FCRLM1; FCRL; FCRLa; FCRLb; FCRLc1; FCRLc2; FCRLd; FCRLe; FCRLX; FREB; MGC4595; fc receptor-like protein; Fc receptor related protein X; fc receptor-related protein X; Fc receptor-like and mucin-like 1; fc receptor homolog expressed in B-cells; fc receptor-like and mucin-like protein 1; Fc receptor homolog expressed in B cells (FREB); FCRX; FCRL1; FCRLM1; RP11-474I16.5
• Gene ID: 84824
• mRNA Refseq: NM_001184866
• Protein Refseq: NP_001171795
• MIM: 606891
• UniProt ID: Q7L513