Recombinant Human FCRLA protein, His-tagged
| Cat.No. : | FCRLA-3756H |
| Product Overview : | Recombinant Human FCRLA protein(275-376 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 275-376 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | IRVQGASSSAAPPTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHQKPGTTKATAE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FCRLA Fc receptor-like A [ Homo sapiens ] |
| Official Symbol | FCRLA |
| Synonyms | FCRLA; Fc receptor-like A; Fc receptor like and mucin like 1 , FCRLM1; FCRL; FCRLa; FCRLb; FCRLc1; FCRLc2; FCRLd; FCRLe; FCRLX; FREB; MGC4595; fc receptor-like protein; Fc receptor related protein X; fc receptor-related protein X; Fc receptor-like and mucin-like 1; fc receptor homolog expressed in B-cells; fc receptor-like and mucin-like protein 1; Fc receptor homolog expressed in B cells (FREB); FCRX; FCRL1; FCRLM1; RP11-474I16.5; |
| Gene ID | 84824 |
| mRNA Refseq | NM_001184866 |
| Protein Refseq | NP_001171795 |
| MIM | 606891 |
| UniProt ID | Q7L513 |
| ◆ Recombinant Proteins | ||
| Fcrla-2979M | Recombinant Mouse Fcrla Protein, Myc/DDK-tagged | +Inquiry |
| FCRLA-3198M | Recombinant Mouse FCRLA Protein, His (Fc)-Avi-tagged | +Inquiry |
| FCRLA-4784HF | Recombinant Full Length Human FCRLA Protein, GST-tagged | +Inquiry |
| FCRLA-2368H | Recombinant Human FCRLA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FCRLA-3756H | Recombinant Human FCRLA protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCRLA-6273HCL | Recombinant Human FCRLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCRLA Products
Required fields are marked with *
My Review for All FCRLA Products
Required fields are marked with *
