Recombinant Human FCRLA protein, His-tagged

Cat.No. : FCRLA-3756H
Product Overview : Recombinant Human FCRLA protein(275-376 aa), fused to His tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 275-376 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : IRVQGASSSAAPPTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHQKPGTTKATAE
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FCRLA Fc receptor-like A [ Homo sapiens ]
Official Symbol FCRLA
Synonyms FCRLA; Fc receptor-like A; Fc receptor like and mucin like 1 , FCRLM1; FCRL; FCRLa; FCRLb; FCRLc1; FCRLc2; FCRLd; FCRLe; FCRLX; FREB; MGC4595; fc receptor-like protein; Fc receptor related protein X; fc receptor-related protein X; Fc receptor-like and mucin-like 1; fc receptor homolog expressed in B-cells; fc receptor-like and mucin-like protein 1; Fc receptor homolog expressed in B cells (FREB); FCRX; FCRL1; FCRLM1; RP11-474I16.5;
Gene ID 84824
mRNA Refseq NM_001184866
Protein Refseq NP_001171795
MIM 606891
UniProt ID Q7L513

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FCRLA Products

Required fields are marked with *

My Review for All FCRLA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon