Recombinant Human FDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FDX1-4341H
Product Overview : FDX1 MS Standard C13 and N15-labeled recombinant protein (NP_004100) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21.
Molecular Mass : 19.4 kDa
AA Sequence : MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FDX1 ferredoxin 1 [ Homo sapiens (human) ]
Official Symbol FDX1
Synonyms FDX1; ferredoxin 1; FDX; adrenodoxin, mitochondrial; adrenodoxin; ADX; ferredoxin-1; hepatoredoxin; adrenal ferredoxin; mitochondrial adrenodoxin; LOH11CR1D;
Gene ID 2230
mRNA Refseq NM_004109
Protein Refseq NP_004100
MIM 103260
UniProt ID P10109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FDX1 Products

Required fields are marked with *

My Review for All FDX1 Products

Required fields are marked with *

0
cart-icon