Recombinant Human FDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FDX1-4341H |
Product Overview : | FDX1 MS Standard C13 and N15-labeled recombinant protein (NP_004100) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. |
Molecular Mass : | 19.4 kDa |
AA Sequence : | MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FDX1 ferredoxin 1 [ Homo sapiens (human) ] |
Official Symbol | FDX1 |
Synonyms | FDX1; ferredoxin 1; FDX; adrenodoxin, mitochondrial; adrenodoxin; ADX; ferredoxin-1; hepatoredoxin; adrenal ferredoxin; mitochondrial adrenodoxin; LOH11CR1D; |
Gene ID | 2230 |
mRNA Refseq | NM_004109 |
Protein Refseq | NP_004100 |
MIM | 103260 |
UniProt ID | P10109 |
◆ Recombinant Proteins | ||
FDX1-2310R | Recombinant Rat FDX1 Protein | +Inquiry |
FDX1-2896B | Recombinant Bovine FDX1 protein, His-tagged | +Inquiry |
FDX1-12835H | Recombinant Human FDX1, GST-tagged | +Inquiry |
FDX1-5805M | Recombinant Mouse FDX1 Protein | +Inquiry |
FDX1-2624B | Recombinant Bovine FDX1 Protein (59-186 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FDX1-6270HCL | Recombinant Human FDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FDX1 Products
Required fields are marked with *
My Review for All FDX1 Products
Required fields are marked with *
0
Inquiry Basket