Recombinant Human FER protein, GST-tagged

Cat.No. : FER-1869H
Product Overview : Recombinant Human FER protein(96-445 aa), fused to GST tag, was expressed in E. coli.
Availability December 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 96-445 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FER fer (fps/fes related) tyrosine kinase [ Homo sapiens ]
Official Symbol FER
Synonyms FER; fer (fps/fes related) tyrosine kinase; tyrosine-protein kinase Fer; phosphoprotein NCP94; PPP1R74; protein phosphatase 1; regulatory subunit 74; TYK3; p94-Fer; tyrosine kinase 3; proto-oncogene c-Fer; feline encephalitis virus-related kinase FER; protein phosphatase 1, regulatory subunit 74; fujinami poultry sarcoma/Feline sarcoma-related protein Fer; FerT;
Gene ID 2241
mRNA Refseq NM_005246
Protein Refseq NP_005237
MIM 176942
UniProt ID P16591

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FER Products

Required fields are marked with *

My Review for All FER Products

Required fields are marked with *

0
cart-icon
0
compare icon