Recombinant Human FER protein, GST-tagged
Cat.No. : | FER-1869H |
Product Overview : | Recombinant Human FER protein(96-445 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 96-445 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FER fer (fps/fes related) tyrosine kinase [ Homo sapiens ] |
Official Symbol | FER |
Synonyms | FER; fer (fps/fes related) tyrosine kinase; tyrosine-protein kinase Fer; phosphoprotein NCP94; PPP1R74; protein phosphatase 1; regulatory subunit 74; TYK3; p94-Fer; tyrosine kinase 3; proto-oncogene c-Fer; feline encephalitis virus-related kinase FER; protein phosphatase 1, regulatory subunit 74; fujinami poultry sarcoma/Feline sarcoma-related protein Fer; FerT; |
Gene ID | 2241 |
mRNA Refseq | NM_005246 |
Protein Refseq | NP_005237 |
MIM | 176942 |
UniProt ID | P16591 |
◆ Recombinant Proteins | ||
FER-1242H | Recombinant Human FER protein(563-816aa), His-tagged | +Inquiry |
FER-1324S | Recombinant Human FER Protein (M1-T822), GST tagged | +Inquiry |
FER-9911HF | Active Recombinant Full Length Human FER Protein, GST-tagged | +Inquiry |
FER-2611H | Recombinant Human FER, GST-tagged | +Inquiry |
FER-2706H | Recombinant Human FER, GST-His | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FER Products
Required fields are marked with *
My Review for All FER Products
Required fields are marked with *