Recombinant Human FFAR2 Protein, GST-tagged

• Cat.No.: FFAR2-4085H
• Product Overview: Human FFAR2 partial ORF (NP_005297.1, 231 a.a. - 330 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 231-330 a.a.
• Description: This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: FLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FFAR2 free fatty acid receptor 2 [ Homo sapiens ]
• Official Symbol: FFAR2
• Synonyms: FFA2R; GPR43; Free Fatty Acid Receptor 2; G-Protein Coupled Receptor 43; GPR43; Free Fatty Acid Activated Receptor 2; G Protein-Coupled Receptor 43; Fatty Acid Receptor 2; GPCR43; FFA2R; FFA2; free fatty acid receptor 2
• Gene ID: 2867
• mRNA Refseq: NM_005306
• Protein Refseq: NP_005297
• MIM: 603823
• UniProt ID: O15552