Recombinant Human FGB Protein, GST-tagged

Cat.No. : FGB-4088H
Product Overview : Human FGB partial ORF ( NP_005132, 392 a.a. - 491 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : GENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FGB fibrinogen beta chain [ Homo sapiens ]
Official Symbol FGB
Synonyms FGB; fibrinogen beta chain; fibrinogen, B beta polypeptide; MGC104327; MGC120405;
Gene ID 2244
mRNA Refseq NM_001184741
Protein Refseq NP_001171670
MIM 134830
UniProt ID P02675

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGB Products

Required fields are marked with *

My Review for All FGB Products

Required fields are marked with *

0
cart-icon
0
compare icon