Recombinant Human FGD6 protein, His-tagged
Cat.No. : | FGD6-2563H |
Product Overview : | Recombinant Human FGD6 protein(289-348 aa), fused to His tag, was expressed in E. coli. |
Availability | August 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 289-348 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ACSSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FGD6 FYVE, RhoGEF and PH domain containing 6 [ Homo sapiens ] |
Official Symbol | FGD6 |
Synonyms | FGD6; FYVE, RhoGEF and PH domain containing 6; FYVE, RhoGEF and PH domain-containing protein 6; FLJ11183; ZFYVE24; zinc finger FYVE domain-containing protein 24; |
Gene ID | 55785 |
mRNA Refseq | NM_018351 |
Protein Refseq | NP_060821 |
MIM | 613520 |
UniProt ID | Q6ZV73 |
◆ Recombinant Proteins | ||
FGD6-5792Z | Recombinant Zebrafish FGD6 | +Inquiry |
FGD6-5836M | Recombinant Mouse FGD6 Protein | +Inquiry |
FGD6-2563H | Recombinant Human FGD6 protein, His-tagged | +Inquiry |
FGD6-3223M | Recombinant Mouse FGD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGD6-621HCL | Recombinant Human FGD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGD6 Products
Required fields are marked with *
My Review for All FGD6 Products
Required fields are marked with *