Recombinant Human FGF1 protein, His-tagged
Cat.No. : | FGF1-2903H |
Product Overview : | Recombinant Human FGF1 protein(P05230)(16-155aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 16-155aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ] |
Official Symbol | FGF1 |
Synonyms | FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha; |
Gene ID | 2246 |
mRNA Refseq | NM_000800 |
Protein Refseq | NP_000791 |
MIM | 131220 |
UniProt ID | P05230 |
◆ Recombinant Proteins | ||
FGF1-2902H | Recombinant Human FGF1 protein, His-SUMO-tagged | +Inquiry |
Fgf1-572M | Recombinant Mouse Fgf1, None tagged | +Inquiry |
FGF1-5837M | Recombinant Mouse FGF1 Protein | +Inquiry |
Fgf1-496M | Recombinant Mouse Fgf1, His-tagged | +Inquiry |
Fgf1-4096R | Active Recombinant Rat Fgf1 Protein | +Inquiry |
◆ Native Proteins | ||
FGF1-26203TH | Native Human FGF1 | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *
0
Inquiry Basket