Recombinant Human FGF12 Protein, GST-tagged
Cat.No. : | FGF12-4102H |
Product Overview : | Human FGF12 full-length ORF ( AAH22524, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq |
Molecular Mass : | 45.65 kDa |
AA Sequence : | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF12 fibroblast growth factor 12 [ Homo sapiens ] |
Official Symbol | FGF12 |
Synonyms | FGF12; fibroblast growth factor 12; FGF12B; FHF1; fibroblast growth factor 12B; fibroblast growth factor FGF 12b; fibroblast growth factor homologous factor 1; myocyte activating factor; FHF-1; FGF-12; myocyte-activating factor; fibroblast growth factor FGF-12b; |
Gene ID | 2257 |
mRNA Refseq | NM_004113 |
Protein Refseq | NP_004104 |
MIM | 601513 |
UniProt ID | P61328 |
◆ Recombinant Proteins | ||
FGF12-26554TH | Recombinant Human FGF12, His-tagged | +Inquiry |
FGF12-026H | Active Recombinant Human FGF12 Protein | +Inquiry |
FGF12-4102H | Recombinant Human FGF12 Protein, GST-tagged | +Inquiry |
FGF12-3238H | Recombinant Human FGF12 Protein (Met1-Gly181), N-His tagged | +Inquiry |
FGF12-105H | Active Recombinant Human FGF12 Protein (Met1-Thr181), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF12-6249HCL | Recombinant Human FGF12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF12 Products
Required fields are marked with *
My Review for All FGF12 Products
Required fields are marked with *