Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
195 |
Description : |
Human FGF-19 is encoded by the FGF19 gene. FGF-19 belongs to the FGF-19 subfamily which has three members FGF-19, 21, 23. FGFs are classically considered to be paracrine factors and are known for their roles in tissue patterning and organogenesis during embryogenesis. By contrast, the FGF-19 subfamily has recently been shown to function in an endocrine manner. Members of this subfamily have poor ability of binding to heparin binding site which is a crucial factor in ligand-receptor complex formation. β-Klotho has been identified as co-factor required for FGF-19, 21, 23 signaling. It can obviously increase ligand-receptor affinity. Unlike most FGFs which bind to and activate more than one FGF receptor, FGF19 is a specific ligand for FGF R4. In FGF-19 transgenic mice, reducing liver triglycerides, increasing fatty acid oxidation, reducing glucose levels and improving insulin sensitivity can be observed. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Assay #1: Fully biologically active when compared to standard. The biological activity is measured by its binding ability in a functional ELISA. Immobilized rHuFGF R4 at 5 µg/ml can bind rHuFGF-19 with a linear range of 3-200 ng/ml.Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 150 ng/ml, corresponding to a specific activity of > 6.7 × 10³ IU/mg. |
Molecular Mass : |
Approximately 21.8 kDa, a single non-glycosylated polypeptide chain containing 195 amino acids. |
AA Sequence : |
MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
Endotoxin : |
Less than 1 EU/µg of rHuFGF-19 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |