"FGF4" Related Products

Expand

Recombinant Human FGF4 Protein

Cat.No. : FGF4-4113H
Product Overview : Human FGF4 (P08620) recombinant protein expressed in Escherichia coli.
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. [provided by RefSeq
Source : E. coli
Species : Human
Form : Lyophilized
Bio-activity : The activity is determined by the ability to induce the proliferation of mouse NR6R-3T3 fibroblasts. The expected ED50 for this effect is less than 0.1 ng/mL.
Molecular Mass : 19 kDa
AA Sequence : MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Endotoxin : < 0.1 EU/μg
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade or lower. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from 0.5X PBS, pH 7.5
Result of activity analysis :

3T3 cells were cultured with 0 to 1 μg/mL human FGF4. Cell proliferation was measured after 42 hours and the linear portion of the curve was us used to calculate the ED50.

Gene Name : FGF4 fibroblast growth factor 4 [ Homo sapiens ]
Official Symbol : FGF4
Synonyms : FGF4; fibroblast growth factor 4; heparin secretory transforming protein 1, HSTF1; HBGF 4; HST; HST 1; human stomach cancer; transforming factor from FGF related oncogene; K FGF; kaposi sarcoma oncogene; KFGF; transforming protein KS3; FGF-4; HSTF-1; oncogene HST; heparin-binding growth factor 4; heparin secretory transforming protein 1; heparin secretory-transforming protein 1; fibroblast growth factor 4 splice isoform; human stomach cancer, transforming factor from FGF-related oncogene; HST-1; HSTF1; K-FGF; HBGF-4;
Gene ID : 2249
mRNA Refseq : NM_002007
Protein Refseq : NP_001998
MIM : 164980
UniProt ID : P08620

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.