Recombinant Human FGF7 Protein, GMP Grade, Animal-Free
Cat.No. : | FGF7-36HG |
Product Overview : | GMP Recombinant Human FGF7 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. |
AA Sequence : | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Purity : | ≥ 95% by SDS-PAGE gel and HPLC analyses. |
Gene Name | FGF7 fibroblast growth factor 7 [ Homo sapiens (human) ] |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7; |
Gene ID | 2252 |
mRNA Refseq | NM_002009 |
Protein Refseq | NP_002000 |
MIM | 148180 |
UniProt ID | P21781 |
◆ Recombinant Proteins | ||
FGF7-3238M | Recombinant Mouse FGF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF7-6333H | Recombinant Human FGF7 protein, For Organoid Culture | +Inquiry |
FGF7-5225D | Recombinant Dog FGF7 protein | +Inquiry |
Fgf7-372R | Active Recombinant Rat Fibroblast Growth Factor 7 | +Inquiry |
FGF7-5226D | Recombinant Dog FGF7 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *