Recombinant Human FGF7 Protein, GMP Grade, Animal-Free

• Cat.No.: FGF7-36HG
• Product Overview: GMP Recombinant Human FGF7 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.

Specification

• Species: Human
• Source: E.coli
• Description: KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation.
• AA Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
• Purity: ≥ 95% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: FGF7 fibroblast growth factor 7 [ Homo sapiens (human) ]
• Official Symbol: FGF7
• Synonyms: FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7
• Gene ID: 2252
• mRNA Refseq: NM_002009
• Protein Refseq: NP_002000
• MIM: 148180
• UniProt ID: P21781