Recombinant Human FGF7 Protein, GMP Grade, Animal-Free

Cat.No. : FGF7-36HG
Product Overview : GMP Recombinant Human FGF7 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : KGF (FGF-7) is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation.
AA Sequence : CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Purity : ≥ 95% by SDS-PAGE gel and HPLC analyses.
Gene Name FGF7 fibroblast growth factor 7 [ Homo sapiens (human) ]
Official Symbol FGF7
Synonyms FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7;
Gene ID 2252
mRNA Refseq NM_002009
Protein Refseq NP_002000
MIM 148180
UniProt ID P21781

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF7 Products

Required fields are marked with *

My Review for All FGF7 Products

Required fields are marked with *

0
cart-icon
0
compare icon