Recombinant Human FGF9 protein

Cat.No. : FGF9-107H
Product Overview : Recombinant Human FGF9 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 207
Description : Fibroblast growth factor-9 (FGF-9) is a member of the fibroblast growth factor (FGF) family. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. FGF-9 is a monomer and interacts with FGFR1, FGFR2, FGFR3 and FGFR4. The human FGF-9 shares 98 % a.a. sequence identity with mouse, rat, equine, porcine, and bovine FGF-9.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 23.3 kDa, a single non-glycosylated polypeptide chain containing 207 amino acids.
AA Sequence : APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Endotoxin : Less than 1 EU/µg of rHuFGF-9 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 1 × PBS to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF9
Official Symbol FGF9
Synonyms FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915;
Gene ID 2254
mRNA Refseq NM_002010
Protein Refseq NP_002001
MIM 600921
UniProt ID P31371

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF9 Products

Required fields are marked with *

My Review for All FGF9 Products

Required fields are marked with *

0
cart-icon