Recombinant Human FGF9 Protein, GST-tagged
Cat.No. : | FGF9-4117H |
Product Overview : | Human FGF9 partial ORF ( NP_002001, 99 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | SIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF9 fibroblast growth factor 9 (glia-activating factor) [ Homo sapiens ] |
Official Symbol | FGF9 |
Synonyms | FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915; |
Gene ID | 2254 |
mRNA Refseq | NM_002010 |
Protein Refseq | NP_002001 |
MIM | 600921 |
UniProt ID | P31371 |
◆ Recombinant Proteins | ||
FGF9-202H | Active Recombinant Human FGF9 protein, hFc-tagged | +Inquiry |
Fgf9-586R | Active Recombinant Rat Fgf9 | +Inquiry |
FGF9-647H | Recombinant Human FGF9 protein, His-tagged | +Inquiry |
FGF9-4117H | Recombinant Human FGF9 Protein, GST-tagged | +Inquiry |
FGF9-16H | Recombinant Human FGF9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
FGF9-001CCL | Recombinant Canine FGF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF9 Products
Required fields are marked with *
My Review for All FGF9 Products
Required fields are marked with *
0
Inquiry Basket