Recombinant Human FGF9 Protein, GST-tagged

Cat.No. : FGF9-4117H
Product Overview : Human FGF9 partial ORF ( NP_002001, 99 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : SIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FGF9 fibroblast growth factor 9 (glia-activating factor) [ Homo sapiens ]
Official Symbol FGF9
Synonyms FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915;
Gene ID 2254
mRNA Refseq NM_002010
Protein Refseq NP_002001
MIM 600921
UniProt ID P31371

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF9 Products

Required fields are marked with *

My Review for All FGF9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon