Recombinant Human FGFR3 Protein, GST-tagged
Cat.No. : | FGFR3-4137H |
Product Overview : | Human FGFR3 partial ORF ( NP_000133, 27 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. Three alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | TEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGFR3 fibroblast growth factor receptor 3 [ Homo sapiens ] |
Official Symbol | FGFR3 |
Synonyms | FGFR3; fibroblast growth factor receptor 3; ACH, achondroplasia, thanatophoric dwarfism; CD333; CEK2; JTK4; FGFR-3; tyrosine kinase JTK4; hydroxyaryl-protein kinase; ACH; HSFGFR3EX; |
Gene ID | 2261 |
mRNA Refseq | NM_000142 |
Protein Refseq | NP_000133 |
MIM | 134934 |
UniProt ID | P22607 |
◆ Recombinant Proteins | ||
FGFR3-1224CAF555 | Recombinant Cynomolgus FGFR3 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
FGFR3-151H | Recombinant Human FGFR3 Protein, His-tagged | +Inquiry |
FGFR3-611H | Active Recombinant Human FGFR3, Fc-tagged | +Inquiry |
FGFR3-610H | Active Recombinant Human FGFR3, Fc-tagged, Biotinylated | +Inquiry |
FGFR3-751HAF555 | Recombinant Human FGFR3 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR3-2596MCL | Recombinant Mouse FGFR3 cell lysate | +Inquiry |
FGFR3-001CCL | Recombinant Cynomolgus FGFR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR3 Products
Required fields are marked with *
My Review for All FGFR3 Products
Required fields are marked with *
0
Inquiry Basket