Recombinant Human FGFR3 protein, His-B2M-tagged
| Cat.No. : | FGFR3-2917H |
| Product Overview : | Recombinant Human FGFR3 protein(P22607)(397-806aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 397-806aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 59.4 kDa |
| AA Sequence : | RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FGFR3 fibroblast growth factor receptor 3 [ Homo sapiens ] |
| Official Symbol | FGFR3 |
| Synonyms | FGFR3; fibroblast growth factor receptor 3; ACH, achondroplasia, thanatophoric dwarfism; CD333; CEK2; JTK4; FGFR-3; tyrosine kinase JTK4; hydroxyaryl-protein kinase; ACH; HSFGFR3EX; |
| Gene ID | 2261 |
| mRNA Refseq | NM_000142 |
| Protein Refseq | NP_000133 |
| MIM | 134934 |
| UniProt ID | P22607 |
| ◆ Recombinant Proteins | ||
| FGFR3-5003H | Recombinant Human Fibroblast Growth Factor Receptor 3 | +Inquiry |
| FGFR3-6094HFL | Recombinant Full Length Human FGFR3, Flag-tagged | +Inquiry |
| Fgfr3-10554M | Recombinant Mouse Fgfr3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGFR3-608H | Recombinant Human FGFR3 protein, His-Avi-tagged | +Inquiry |
| FGFR3-187H | Recombinant Human FGFR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGFR3-2596MCL | Recombinant Mouse FGFR3 cell lysate | +Inquiry |
| FGFR3-001CCL | Recombinant Cynomolgus FGFR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR3 Products
Required fields are marked with *
My Review for All FGFR3 Products
Required fields are marked with *
