Recombinant Human FHL2 protein, His-tagged
Cat.No. : | FHL2-8954H |
Product Overview : | Recombinant Human FHL2 protein(1-279 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-279 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | FHL2 four and a half LIM domains 2 [ Homo sapiens ] |
Official Symbol | FHL2 |
Synonyms | FHL2; four and a half LIM domains 2; four and a half LIM domains protein 2; DRAL; SLIM3; LIM domain protein DRAL; aging-associated gene 11; skeletal muscle LIM-protein 3; four and a half LIM-domain protein 2; down-regulated in rhabdomyosarcoma LIM protein; AAG11; FHL-2; SLIM-3; |
Gene ID | 2274 |
mRNA Refseq | NM_001039492 |
Protein Refseq | NP_001034581 |
MIM | 602633 |
UniProt ID | Q14192 |
◆ Recombinant Proteins | ||
FHL2-8954H | Recombinant Human FHL2 protein, His-tagged | +Inquiry |
FHL2-4958HF | Recombinant Full Length Human FHL2 Protein, GST-tagged | +Inquiry |
FHL2-2345R | Recombinant Rat FHL2 Protein | +Inquiry |
FHL2-6618H | Recombinant Human FHL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FHL2-3251M | Recombinant Mouse FHL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FHL2-6223HCL | Recombinant Human FHL2 293 Cell Lysate | +Inquiry |
FHL2-6224HCL | Recombinant Human FHL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FHL2 Products
Required fields are marked with *
My Review for All FHL2 Products
Required fields are marked with *
0
Inquiry Basket